Recombinant Full Length Human GAPT Protein, GST-tagged

Cat.No. : GAPT-5431HF
Product Overview : Human GAPT full-length ORF (BAC03557.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 157 amino acids
Description : GAPT (GRB2 Binding Adaptor Protein, Transmembrane) is a Protein Coding gene.
Molecular Mass : 44.3 kDa
AA Sequence : MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLRHEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPDSY
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GAPT GRB2-binding adaptor protein, transmembrane [ Homo sapiens ]
Official Symbol GAPT
Synonyms C5orf29; GAPT; GRB2-binding adaptor protein, transmembrane
Gene ID 202309
mRNA Refseq NM_152687
Protein Refseq NP_689900
UniProt ID Q8N292

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GAPT Products

Required fields are marked with *

My Review for All GAPT Products

Required fields are marked with *

0
cart-icon