Recombinant Human GAPT Protein, GST-tagged
| Cat.No. : | GAPT-4727H |
| Product Overview : | Human GAPT full-length ORF (BAC03557.1, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GAPT (GRB2 Binding Adaptor Protein, Transmembrane) is a Protein Coding gene. |
| Molecular Mass : | 44.3 kDa |
| AA Sequence : | MSKSCGNNLAAISVGISLLLLLVVCGIGCVWHWKHRVATRFTLPRFLQRRSSRRKVCTKTFLGPRIIGLRHEISVETQDHKSAVRGNNTHDNYENVEAGPPKAKGKTDKELYENTGQSNFEEHIYGNETSSDYYNFQKPRPSEVPQDEDIYILPDSY |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GAPT GRB2-binding adaptor protein, transmembrane [ Homo sapiens ] |
| Official Symbol | GAPT |
| Synonyms | C5orf29; GAPT; GRB2-binding adaptor protein, transmembrane |
| Gene ID | 202309 |
| mRNA Refseq | NM_152687 |
| Protein Refseq | NP_689900 |
| UniProt ID | Q8N292 |
| ◆ Recombinant Proteins | ||
| GAPT-1491H | Recombinant Human GAPT | +Inquiry |
| GAPT-1813R | Recombinant Rhesus monkey GAPT Protein, His-tagged | +Inquiry |
| GAPT-5431HF | Recombinant Full Length Human GAPT Protein, GST-tagged | +Inquiry |
| GAPT-1634R | Recombinant Rhesus Macaque GAPT Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL12202MF | Recombinant Full Length Mouse Protein Gapt(Gapt) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GAPT-6022HCL | Recombinant Human GAPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GAPT Products
Required fields are marked with *
My Review for All GAPT Products
Required fields are marked with *
