Recombinant Full Length Human GATC Protein, GST-tagged
| Cat.No. : | GATC-5478HF |
| Product Overview : | Human GATC full-length ORF ( NP_789788.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 136 amino acids |
| Description : | GATC (Glutamyl-TRNA Amidotransferase Subunit C) is a Protein Coding gene. Among its related pathways are Metabolism and tRNA Aminoacylation. GO annotations related to this gene include glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity. An important paralog of this gene is ENSG00000111780. |
| Molecular Mass : | 41.5 kDa |
| AA Sequence : | MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GATC glutamyl-tRNA amidotransferase subunit C [ Homo sapiens (human) ] |
| Official Symbol | GATC |
| Synonyms | GATC; glutamyl-tRNA amidotransferase subunit C; 15E1.2; glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial; glu-AdT subunit C; glutamyl-tRNA(Gln) amidotransferase, subunit C homolog; EC 6.3.5.- |
| Gene ID | 283459 |
| mRNA Refseq | NM_176818 |
| Protein Refseq | NP_789788 |
| MIM | 617210 |
| UniProt ID | O43716 |
| ◆ Recombinant Proteins | ||
| GATC-2999S | Recombinant Staphylococcus epidermidis ATCC 12228 GATC protein, His-tagged | +Inquiry |
| GATC-1265B | Recombinant Bacillus subtilis GATC protein, His-tagged | +Inquiry |
| GATC-6231M | Recombinant Mouse GATC Protein | +Inquiry |
| GATC-5478HF | Recombinant Full Length Human GATC Protein, GST-tagged | +Inquiry |
| GATC-1080S | Recombinant Streptomyces coelicolor A3(2) GATC protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GATC-6006HCL | Recombinant Human GATC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATC Products
Required fields are marked with *
My Review for All GATC Products
Required fields are marked with *
