Recombinant Full Length Human GATC Protein, GST-tagged
Cat.No. : | GATC-5478HF |
Product Overview : | Human GATC full-length ORF ( NP_789788.1, 1 a.a. - 136 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 136 amino acids |
Description : | GATC (Glutamyl-TRNA Amidotransferase Subunit C) is a Protein Coding gene. Among its related pathways are Metabolism and tRNA Aminoacylation. GO annotations related to this gene include glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity. An important paralog of this gene is ENSG00000111780. |
Molecular Mass : | 41.5 kDa |
AA Sequence : | MWSRLVWLGLRAPLGGRQGFTSKADPQGSGRITAAVIEHLERLALVDFGSREAVARLEKAIAFADRLRAVDTDGVEPMESVLEDRCLYLRSDNVVEGNCADELLQNSHRVVEEYFVAPPGNISLPKLDEQEPFPHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GATC glutamyl-tRNA amidotransferase subunit C [ Homo sapiens (human) ] |
Official Symbol | GATC |
Synonyms | GATC; glutamyl-tRNA amidotransferase subunit C; 15E1.2; glutamyl-tRNA(Gln) amidotransferase subunit C, mitochondrial; glu-AdT subunit C; glutamyl-tRNA(Gln) amidotransferase, subunit C homolog; EC 6.3.5.- |
Gene ID | 283459 |
mRNA Refseq | NM_176818 |
Protein Refseq | NP_789788 |
MIM | 617210 |
UniProt ID | O43716 |
◆ Recombinant Proteins | ||
GATC-3488M | Recombinant Mouse GATC Protein, His (Fc)-Avi-tagged | +Inquiry |
GATC-229H | Recombinant Human glutamyl-tRNA(Gln) amidotransferase, subunit C, His-tagged | +Inquiry |
GATC-5478HF | Recombinant Full Length Human GATC Protein, GST-tagged | +Inquiry |
GATC-2942H | Recombinant Human GATC protein, GST-tagged | +Inquiry |
GATC-1265B | Recombinant Bacillus subtilis GATC protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATC-6006HCL | Recombinant Human GATC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GATC Products
Required fields are marked with *
My Review for All GATC Products
Required fields are marked with *
0
Inquiry Basket