Recombinant Full Length Human GATM Protein, C-Flag-tagged
Cat.No. : | GATM-833HFL |
Product Overview : | Recombinant Full Length Human GATM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a mitochondrial enzyme that belongs to the amidinotransferase family. This enzyme is involved in creatine biosynthesis, whereby it catalyzes the transfer of a guanido group from L-arginine to glycine, resulting in guanidinoacetic acid, the immediate precursor of creatine. Mutations in this gene cause arginine:glycine amidinotransferase deficiency, an inborn error of creatine synthesis characterized by cognitive disability, language impairment, and behavioral disorders. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 44.2 kDa |
AA Sequence : | MLRVRCLRGGSRGAEAVHYIGSRLGRTLTGWVQRTFQSTQAATASSRNSCAADDKATEPLPKDCPVSSYN EWDPLEEVIVGRAENACVPPFTIEVKANTYEKYWPFYQKQGGHYFPKDHLKKAVAEIEEMCNILKTEGVT VRRPDPIDWSLKYKTPDFESTGLYSAMPRDILIVVGNEIIEAPMAWRSRFFEYRAYRSIIKDYFHRGAKW TTAPKPTMADELYNQDYPIHSVEDRHKLAAQGKFVTTEFEPCFDAADFIRAGRDIFAQRSQVTNYLGIEW MRRHLAPDYRVHIISFKDPNPMHIDATFNIIGPGIVLSNPDRPCHQIDLFKKAGWTIITPPTPIIPDDHP LWMSSKWLSMNVLMLDEKRVMVDANEVPIQKMFEKLGITTIKVNIRNANSLGGGFHCWTCDVRRRGTLQS YLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Arginine and proline metabolism, Glycine, serine and threonine metabolism, Metabolic pathways |
Full Length : | Full L. |
Gene Name | GATM glycine amidinotransferase [ Homo sapiens (human) ] |
Official Symbol | GATM |
Synonyms | AT; AGAT; CCDS3; FRTS1 |
Gene ID | 2628 |
mRNA Refseq | NM_001482.3 |
Protein Refseq | NP_001473.1 |
MIM | 602360 |
UniProt ID | P50440 |
◆ Recombinant Proteins | ||
GATM-9937Z | Recombinant Zebrafish GATM | +Inquiry |
GATM-283C | Recombinant Cynomolgus Monkey GATM Protein, His (Fc)-Avi-tagged | +Inquiry |
GATM-28986TH | Recombinant Human GATM | +Inquiry |
GATM-965H | Recombinant Human GATM Protein, His (Fc)-Avi-tagged | +Inquiry |
GATM-833HFL | Recombinant Full Length Human GATM Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GATM-6005HCL | Recombinant Human GATM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GATM Products
Required fields are marked with *
My Review for All GATM Products
Required fields are marked with *
0
Inquiry Basket