Recombinant Full Length Human GBAS Protein, GST-tagged

Cat.No. : GBAS-5519HF
Product Overview : Human GBAS full-length ORF (1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 247 amino acids
Description : Chromosomal region 7p12, which contains GBAS, is amplified in approximately 40% of glioblastomas, the most common and malignant form of central nervous system tumor.The predicted 286-amino acid protein contains a signal peptide, a transmembrane domain, and 2 tyrosine phosphorylation sites. The GBAS transcript is expressed most abundantly in heart and skeletal muscle. GBAS protein might be involved in vesicular transport. [provided by RefSeq
Molecular Mass : 55.5 kDa
AA Sequence : MAARVLRARGAAWAGGLLQRAAPCSLLPRLRTWTSSSNRSREDSWLKSLFVRKVDPRKDAHSNLLAKKETSNLYKLQFKRCCQRFTKINTTLVLWWGLGTRGMASRTKLEFLEFRKARSDMLLSRKNQLLLEFSFWNEPVPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIGQLYMVHHLWAYRDLQTREDIRNAAWHKHGWEELVYYTVPLIQEMESRIMIPLKTSPLQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GBAS glioblastoma amplified sequence [ Homo sapiens ]
Official Symbol GBAS
Synonyms GBAS; glioblastoma amplified sequence; protein NipSnap homolog 2; NIPSNAP2; 4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 2;
Gene ID 2631
mRNA Refseq NM_001202469
Protein Refseq NP_001189398
MIM 603004
UniProt ID O75323

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GBAS Products

Required fields are marked with *

My Review for All GBAS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon