Recombinant Full Length Human GBP2 Protein, C-Flag-tagged
Cat.No. : | GBP2-1800HFL |
Product Overview : | Recombinant Full Length Human GBP2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the guanine-binding protein (GBP) family, which includes interferon-induced proteins that can bind to guanine nucleotides (GMP, GDP and GTP). The encoded protein is a GTPase which hydrolyzes GTP, predominantly to GDP. The protein may play a role as a marker of squamous cell carcinomas. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67 kDa |
AA Sequence : | MAPEINLPGPMSLIDNTKGQLVVNPEALKILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKKNGFSLGST VKSHTKGIWMWCVPHPKKPEHTLVLLDTEGLGDIEKGDNENDSWIFALAILLSSTFVYNSMGTINQQAMD QLHYVTELTDRIKANSSPGNNSVDDSADFVSFFPAFVWTLRDFTLELEVDGEPITADDYLELSLKLRKGT DKKSKSFNDPRLCIRKFFPKRKCFVFDWPAPKKYLAHLEQLKEEELNPDFIEQVAEFCSYILSHSNVKTL SGGIPVNGPRLESLVLTYVNAISSGDLPCRENAVLALAQIENSAAVEKAIAHYEQQMGQKVQLPTETLQE LLDLHRDSEREAIEVFMKNSFKDVDQMFQRKLGAQLEARRDDFCKQNSKASSDCCMALLQDIFGPLEEDV KQGTFSKPGGYRLFTQKLQELKNKYYQVPRKGIQAKEVLKKYLESKEDVADALLQTDQSLSEKEKAIEVE RIKAESAEAAKKMLEEIQKKNEEMMEQKEKSYQEHVKQLTEKMERDRAQLMAEQEKTLALKLQEQERLLK EGFENESKRLQKDIWDIQMRSKSLEPICNIL myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | GBP2 guanylate binding protein 2 [ Homo sapiens (human) ] |
Official Symbol | GBP2 |
Gene ID | 2634 |
mRNA Refseq | NM_004120.5 |
Protein Refseq | NP_004111.2 |
MIM | 600412 |
UniProt ID | P32456 |
◆ Recombinant Proteins | ||
GBP2-4062H | Recombinant Human GBP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GBP2-3829H | Recombinant Human GBP2 protein(100-259aa), His-tagged | +Inquiry |
Gbp2-1261R | Recombinant Rat Gbp2 protein, His & T7-tagged | +Inquiry |
GBP2-6244M | Recombinant Mouse GBP2 Protein | +Inquiry |
GBP2-8632H | Recombinant Human GBP2 protein(Met1-Cys588), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBP2-1337HCL | Recombinant Human GBP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GBP2 Products
Required fields are marked with *
My Review for All GBP2 Products
Required fields are marked with *
0
Inquiry Basket