Recombinant Full Length Human GBP5 Protein, C-Flag-tagged
Cat.No. : | GBP5-1159HFL |
Product Overview : | Recombinant Full Length Human GBP5 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene belongs to the TRAFAC class dynamin-like GTPase superfamily. The encoded protein acts as an activator of NLRP3 inflammasome assembly and has a role in innate immunity and inflammation. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 66.4 kDa |
AA Sequence : | MALEIHMSDPMCLIENFNEQLKVNQEALEILSAITQPVVVVAIVGLYRTGKSYLMNKLAGKNKGFSVAST VQSHTKGIWIWCVPHPNWPNHTLVLLDTEGLGDVEKADNKNDIQIFALALLLSSTFVYNTVNKIDQGAID LLHNVTELTDLLKARNSPDLDRVEDPADSASFFPDLVWTLRDFCLGLEIDGQLVTPDEYLENSLRPKQGS DQRVQNFNLPRLCIQKFFPKKKCFIFDLPAHQKKLAQLETLPDDELEPEFVQQVTEFCSYIFSHSMTKTL PGGIMVNGSRLKNLVLTYVNAISSGDLPCIENAVLALAQRENSAAVQKAIAHYDQQMGQKVQLPMETLQE LLDLHRTSEREAIEVFMKNSFKDVDQSFQKELETLLDAKQNDICKRNLEASSDYCSALLKDIFGPLEEAV KQGIYSKPGGHNLFIQKTEELKAKYYREPRKGIQAEEVLQKYLKSKESVSHAILQTDQALTETEKKKKEA QVKAEAEKAEAQRLAAIQRQNEQMMQERERLHQEQVRQMEIAKQNWLAEQQKMQEQQMQEQAAQLSTTFQ AQNRSLLSELQHAQRTVNNDDPCVLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | GBP5 guanylate binding protein 5 [ Homo sapiens (human) ] |
Official Symbol | GBP5 |
Synonyms | GBP-5 |
Gene ID | 115362 |
mRNA Refseq | NM_001134486.4 |
Protein Refseq | NP_001127958.1 |
MIM | 611467 |
UniProt ID | Q96PP8 |
◆ Recombinant Proteins | ||
GBP5-1258H | Recombinant Human GBP5 protein, His & T7-tagged | +Inquiry |
GBP5-6417H | Recombinant Human GBP5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GBP5-5529HF | Recombinant Full Length Human GBP5 Protein, GST-tagged | +Inquiry |
GBP5-13183H | Recombinant Human GBP5, GST-tagged | +Inquiry |
GBP5-1159HFL | Recombinant Full Length Human GBP5 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBP5-5997HCL | Recombinant Human GBP5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GBP5 Products
Required fields are marked with *
My Review for All GBP5 Products
Required fields are marked with *
0
Inquiry Basket