Recombinant Full Length Human GC Protein, C-Flag-tagged
Cat.No. : | GC-1254HFL |
Product Overview : | Recombinant Full Length Human GC Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the albumin gene family. It is a multifunctional protein found in plasma, ascitic fluid, cerebrospinal fluid and on the surface of many cell types. It binds to vitamin D and its plasma metabolites and transports them to target tissues. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 51.1 kDa |
AA Sequence : | MKRVLVLLLAVAFGHALERGRDYEKNKVCKEFSHLGKEDFTSLSLVLYSRKFPSGTFEQVSQLVKEVVSL TEACCAEGADPDCYDTRTSALSAKSCESNSPFPVHPGTAECCTKEGLERKLCMAALKHQPQEFPTYVEPT NDEICEAFRKDPKEYANQFMWEYSTNYGQAPLSLLVSYTKSYLSMVGSCCTSASPTVCFLKERLQLKHLS LLTTLSNRVCSQYAAYGEKKSRLSNLIKLAQKVPTADLEDVLPLAEDITNILSKCCESASEDCMAKELPE HTVKLCDNLSTKNSKFEDCCQEKTAMDVFVCTYFMPAAQLPELPDVELPTNKDVCDPGNTKVMDKYTFEL SRRTHLPEVFLSKVLEPTLKSLGECCDVEDSTTCFNAKGPLLKKELSSFIDKGQELCADYSENTFTEYKK KLAERLKAKLPDATPTELAKLVNKRSDFASNCCSINSPPLYCDSEIDAELKNILTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | GC GC vitamin D binding protein [ Homo sapiens (human) ] |
Official Symbol | GC |
Synonyms | DBP; VDB; GRD3; VDBG; VDBP; GcMAF; DBP/GC; Gc-MAF; DBP-maf; HEL-S-51 |
Gene ID | 2638 |
mRNA Refseq | NM_000583.4 |
Protein Refseq | NP_000574.2 |
MIM | 139200 |
UniProt ID | P02774 |
◆ Recombinant Proteins | ||
GC-1320H | Recombinant Human GC Protein, MYC/DDK-tagged | +Inquiry |
GC-5160HF | Recombinant Full Length Human GC Protein, GST-tagged | +Inquiry |
Gc-5410M | Recombinant Mouse Gc protein, His-tagged | +Inquiry |
GC-1824H | Recombinant Human GC protein, His-tagged | +Inquiry |
GC-01H | Active Recombinant Human GC Protein (Leu17-Leu474, K436T), C-6×His-tagged | +Inquiry |
◆ Native Proteins | ||
GC-198H | Native Human GC-Globulin | +Inquiry |
GC-524H | Native Human GC protein | +Inquiry |
GC-29857TH | Native Human GC | +Inquiry |
◆ Cell & Tissue Lysates | ||
GC-5995HCL | Recombinant Human GC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GC Products
Required fields are marked with *
My Review for All GC Products
Required fields are marked with *
0
Inquiry Basket