Recombinant Full Length Human GCH1 Protein

Cat.No. : GCH1-183HF
Product Overview : Recombinant full length Human GTP cyclohydrolase 1 with N-terminal proprietary tag.Mol Wt 53.61 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 251 amino acids
Description : This gene encodes a member of the GTP cyclohydrolase family. The encoded protein is the first and rate-limiting enzyme in tetrahydrobiopterin (BH4) biosynthesis, catalyzing the conversion of GTP into 7,8-dihydroneopterin triphosphate. BH4 is an essential cofactor required by aromatic amino acid hydroxylases as well as nitric oxide synthases. Mutations in this gene are associated with malignant hyperphenylalaninemia and dopa-responsive dystonia. Several alternatively spliced transcript variants encoding different isoforms have been described; however, not all variants give rise to a functional enzyme.
Form : Liquid
Molecular Mass : 53.610kDa inclusive of tags
AA Sequence : MEKGPVRAPAEKPRGARCSNGFPERDPPRPGPSRPAEKPP RPEAKSAQPADGWKGERPRSEEDNELNLPNLAAAYSSILS SLGENPQRQGLLKTPWRAASAMQFFTKGYQETISDVLNDA IFDEDHDEMVIVKDIDMFSMCEHHLVPFVGKVHIGYLPNK QVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALRPA GVGVVVEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKT REEFLTLIRS
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name GCH1 GTP cyclohydrolase 1 [ Homo sapiens ]
Official Symbol GCH1
Synonyms GCH1; GTP cyclohydrolase 1; dystonia 14 , DYT5, DYT14, GCH; dopa responsive dystonia; DYT5a; GTPCH1
Gene ID 2643
mRNA Refseq NM_000161
Protein Refseq NP_000152
MIM 600225
UniProt ID P30793

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GCH1 Products

Required fields are marked with *

My Review for All GCH1 Products

Required fields are marked with *

0
cart-icon