Recombinant Full Length Human GDI1 Protein, C-Flag-tagged
Cat.No. : | GDI1-1212HFL |
Product Overview : | Recombinant Full Length Human GDI1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Protein Length : | 1-447 aa |
Description : | GDP dissociation inhibitors are proteins that regulate the GDP-GTP exchange reaction of members of the rab family, small GTP-binding proteins of the ras superfamily, that are involved in vesicular trafficking of molecules between cellular organelles. GDIs slow the rate of dissociation of GDP from rab proteins and release GDP from membrane-bound rabs. GDI1 is expressed primarily in neural and sensory tissues. Mutations in GDI1 have been linked to X-linked nonspecific cognitive disability. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.4 kDa |
AA Sequence : | MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGR DWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRF RKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIK LYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQL ICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYI AIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDI YKRMAGTAFDFENMKRKQNDVFGEAEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | GDI1 GDP dissociation inhibitor 1 [ Homo sapiens (human) ] |
Official Symbol | GDI1 |
Synonyms | 1A; GDIL; MRX41; MRX48; OPHN2; XAP-4; XLID41; RABGD1A; RABGDIA |
Gene ID | 2664 |
mRNA Refseq | NM_001493.3 |
Protein Refseq | NP_001484.1 |
MIM | 300104 |
UniProt ID | P31150 |
◆ Recombinant Proteins | ||
GDI1-2787Z | Recombinant Zebrafish GDI1 | +Inquiry |
GDI1-3524M | Recombinant Mouse GDI1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GDI1-2977H | Recombinant Human GDI1 Protein (Met1-Val274), N-His tagged | +Inquiry |
GDI1-2504R | Recombinant Rat GDI1 Protein | +Inquiry |
GDI1-2448H | Recombinant Human GDI1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDI1-5965HCL | Recombinant Human GDI1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GDI1 Products
Required fields are marked with *
My Review for All GDI1 Products
Required fields are marked with *
0
Inquiry Basket