Recombinant Full Length Human GHITM Protein, GST-tagged
Cat.No. : | GHITM-5251HF |
Product Overview : | Human GHITM full-length ORF ( AAH10354.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 345 amino acids |
Description : | GHITM (Growth Hormone Inducible Transmembrane Protein) is a Protein Coding gene. |
Molecular Mass : | 63.6 kDa |
AA Sequence : | MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GHITM growth hormone inducible transmembrane protein [ Homo sapiens ] |
Official Symbol | GHITM |
Synonyms | GHITM; growth hormone inducible transmembrane protein; growth hormone-inducible transmembrane protein; DERP2; HSPC282; My021; PTD010; TMBIM5; transmembrane BAX inhibitor motif containing 5; dermal papilla-derived protein 2; mitochondrial morphology and cristae structure 1; transmembrane BAX inhibitor motif-containing protein 5; MICS1; FLJ26584; DKFZp566C0746; |
Gene ID | 27069 |
mRNA Refseq | NM_014394 |
Protein Refseq | NP_055209 |
MIM | 619205 |
UniProt ID | Q9H3K2 |
◆ Cell & Tissue Lysates | ||
GHITM-5942HCL | Recombinant Human GHITM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHITM Products
Required fields are marked with *
My Review for All GHITM Products
Required fields are marked with *
0
Inquiry Basket