Recombinant Full Length Human GHITM Protein, GST-tagged

Cat.No. : GHITM-5251HF
Product Overview : Human GHITM full-length ORF ( AAH10354.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 345 amino acids
Description : GHITM (Growth Hormone Inducible Transmembrane Protein) is a Protein Coding gene.
Molecular Mass : 63.6 kDa
AA Sequence : MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GHITM growth hormone inducible transmembrane protein [ Homo sapiens ]
Official Symbol GHITM
Synonyms GHITM; growth hormone inducible transmembrane protein; growth hormone-inducible transmembrane protein; DERP2; HSPC282; My021; PTD010; TMBIM5; transmembrane BAX inhibitor motif containing 5; dermal papilla-derived protein 2; mitochondrial morphology and cristae structure 1; transmembrane BAX inhibitor motif-containing protein 5; MICS1; FLJ26584; DKFZp566C0746;
Gene ID 27069
mRNA Refseq NM_014394
Protein Refseq NP_055209
MIM 619205
UniProt ID Q9H3K2

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GHITM Products

Required fields are marked with *

My Review for All GHITM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon