Recombinant Human GHITM Protein, GST-tagged
| Cat.No. : | GHITM-4886H |
| Product Overview : | Human GHITM full-length ORF ( AAH10354.1, 1 a.a. - 345 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GHITM (Growth Hormone Inducible Transmembrane Protein) is a Protein Coding gene. |
| Molecular Mass : | 63.6 kDa |
| AA Sequence : | MLAARLVCLRTLPSRVFHPAFTKASPVVKNSITKNQWLLTPSREYATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLSNEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIGVTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAGIVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGLVLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GHITM growth hormone inducible transmembrane protein [ Homo sapiens ] |
| Official Symbol | GHITM |
| Synonyms | GHITM; growth hormone inducible transmembrane protein; growth hormone-inducible transmembrane protein; DERP2; HSPC282; My021; PTD010; TMBIM5; transmembrane BAX inhibitor motif containing 5; dermal papilla-derived protein 2; mitochondrial morphology and cristae structure 1; transmembrane BAX inhibitor motif-containing protein 5; MICS1; FLJ26584; DKFZp566C0746; |
| Gene ID | 27069 |
| mRNA Refseq | NM_014394 |
| Protein Refseq | NP_055209 |
| UniProt ID | Q9H3K2 |
| ◆ Recombinant Proteins | ||
| GHITM-10869Z | Recombinant Zebrafish GHITM | +Inquiry |
| GHITM-1664R | Recombinant Rhesus Macaque GHITM Protein, His (Fc)-Avi-tagged | +Inquiry |
| GHITM-1843R | Recombinant Rhesus monkey GHITM Protein, His-tagged | +Inquiry |
| GHITM-3549M | Recombinant Mouse GHITM Protein, His (Fc)-Avi-tagged | +Inquiry |
| GHITM-2527R | Recombinant Rat GHITM Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GHITM-5942HCL | Recombinant Human GHITM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHITM Products
Required fields are marked with *
My Review for All GHITM Products
Required fields are marked with *
