Recombinant Full Length Human GHSR Protein, GST-tagged
Cat.No. : | GHSR-5254HF |
Product Overview : | Human GHSR full-length ORF ( NP_004113.1, 1 a.a. - 289 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 289 amino acids |
Description : | This gene encodes a member of the G-protein coupled receptor family. The encoded protein may play a role in energy homeostasis and regulation of body weight. Two identified transcript variants are expressed in several tissues and are evolutionary conserved in fish and swine. One transcript, 1a, excises an intron and encodes the functional protein; this protein is the receptor for the Ghrelin ligand and defines a neuroendocrine pathway for growth hormone release. The second transcript (1b) retains the intron and does not function as a receptor for Ghrelin; however, it may function to attenuate activity of isoform 1a. [provided by RefSeq |
Molecular Mass : | 58.6 kDa |
AA Sequence : | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAGNLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQFVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFVLVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLWRRRRGDAVVGASLRDQNHKQTVKMLGGSQRALRLSLAGPILSLCLLPSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GHSR growth hormone secretagogue receptor [ Homo sapiens ] |
Official Symbol | GHSR |
Synonyms | GHSR; growth hormone secretagogue receptor; growth hormone secretagogue receptor type 1; GHRP; GHS-R; ghrelin receptor; GH-releasing peptide receptor; |
Gene ID | 2693 |
mRNA Refseq | NM_004122 |
Protein Refseq | NP_004113 |
MIM | 601898 |
UniProt ID | Q92847 |
◆ Recombinant Proteins | ||
GHSR-5964C | Recombinant Chicken GHSR | +Inquiry |
GHSR-1043HFL | Recombinant Human GHSR Full Length Transmembrane protein, Flag-tagged(Synthetic Nanodisc) | +Inquiry |
RFL6718RF | Recombinant Full Length Rat Growth Hormone Secretagogue Receptor Type 1(Ghsr) Protein, His-Tagged | +Inquiry |
GHSR-5254HF | Recombinant Full Length Human GHSR Protein, GST-tagged | +Inquiry |
GHSR-1578H | Recombinant Human GHSR Protein, His&GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GHSR Products
Required fields are marked with *
My Review for All GHSR Products
Required fields are marked with *
0
Inquiry Basket