Recombinant Full Length Human GIMAP6 Protein, GST-tagged

Cat.No. : GIMAP6-5259HF
Product Overview : Human GIMAP6 full-length ORF ( NP_078987.3, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 292 amino acids
Description : This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene. [provided by RefSeq
Molecular Mass : 59.3 kDa
AA Sequence : MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GIMAP6 GTPase, IMAP family member 6 [ Homo sapiens ]
Official Symbol GIMAP6
Synonyms GIMAP6; GTPase, IMAP family member 6; GTPase IMAP family member 6; FLJ22690; immune associated nucleotide 2; immune associated nucleotide 6; IAN2; IAN6; IAN-2; IAN-6; DKFZp686A01175;
Gene ID 474344
mRNA Refseq NM_001244071
Protein Refseq NP_001231000
MIM 616960
UniProt ID Q6P9H5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GIMAP6 Products

Required fields are marked with *

My Review for All GIMAP6 Products

Required fields are marked with *

0
cart-icon