Recombinant Full Length Human GIMAP6 Protein, GST-tagged
| Cat.No. : | GIMAP6-5259HF |
| Product Overview : | Human GIMAP6 full-length ORF ( NP_078987.3, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 292 amino acids |
| Description : | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, IAN subfamily genes are located in a cluster at 7q36.1. Two transcript variants, one protein-coding and the other probably non-protein-coding, have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 59.3 kDa |
| AA Sequence : | MEEEEYEQIPQENPPEELSQDPVLELSGGLREKEQKTPRRLRLILMGKTGSGKSATGNSILGRDVFESKLSTRPVTKTSQRRSREWAGKELEVIDTPNILSPQVSPEVADAICQAIVLSAPGPHAVLLVTQLGRFTDEDQQVVRRLQEVFGVGVLGHTILVFTRKEDLAGGSLEDYVRETNNQALAWLDVTLARRHCGFNNRAQGEEQEAQLRELMEKVEAIMWENEGDYYSNKAYQYTQQNFRLKELQERQVSQGQGSEDVPGEESWLEGLSQIQKESEEAHRCLLGKADL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GIMAP6 GTPase, IMAP family member 6 [ Homo sapiens ] |
| Official Symbol | GIMAP6 |
| Synonyms | GIMAP6; GTPase, IMAP family member 6; GTPase IMAP family member 6; FLJ22690; immune associated nucleotide 2; immune associated nucleotide 6; IAN2; IAN6; IAN-2; IAN-6; DKFZp686A01175; |
| Gene ID | 474344 |
| mRNA Refseq | NM_001244071 |
| Protein Refseq | NP_001231000 |
| MIM | 616960 |
| UniProt ID | Q6P9H5 |
| ◆ Recombinant Proteins | ||
| GIMAP6-15889H | Recombinant Human GIMAP6, His-tagged | +Inquiry |
| GIMAP6-2191R | Recombinant Rat GIMAP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GIMAP6-2535R | Recombinant Rat GIMAP6 Protein | +Inquiry |
| GIMAP6-6352M | Recombinant Mouse GIMAP6 Protein | +Inquiry |
| GIMAP6-3557M | Recombinant Mouse GIMAP6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GIMAP6-706HCL | Recombinant Human GIMAP6 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIMAP6 Products
Required fields are marked with *
My Review for All GIMAP6 Products
Required fields are marked with *
