Recombinant Full Length Human GIMAP7 Protein, GST-tagged
| Cat.No. : | GIMAP7-5260HF |
| Product Overview : | Human GIMAP7 full-length ORF ( NP_694968.1, 1 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 300 amino acids |
| Description : | This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq |
| Molecular Mass : | 60.9 kDa |
| AA Sequence : | MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GIMAP7 GTPase, IMAP family member 7 [ Homo sapiens ] |
| Official Symbol | GIMAP7 |
| Synonyms | GIMAP7; GTPase, IMAP family member 7; GTPase IMAP family member 7; IAN7; MGC27027; IAN-7; immune associated nucleotide; immunity-associated nucleotide 7 protein; hIAN7; |
| Gene ID | 168537 |
| mRNA Refseq | NM_153236 |
| Protein Refseq | NP_694968 |
| MIM | 616961 |
| UniProt ID | Q8NHV1 |
| ◆ Recombinant Proteins | ||
| GIMAP7-4905H | Recombinant Human GIMAP7 Protein, GST-tagged | +Inquiry |
| GIMAP7-6453H | Recombinant Human GIMAP7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| GIMAP7-13258H | Recombinant Human GIMAP7, GST-tagged | +Inquiry |
| GIMAP7-5260HF | Recombinant Full Length Human GIMAP7 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GIMAP7-5936HCL | Recombinant Human GIMAP7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIMAP7 Products
Required fields are marked with *
My Review for All GIMAP7 Products
Required fields are marked with *
