Recombinant Full Length Human GIMAP7 Protein, GST-tagged

Cat.No. : GIMAP7-5260HF
Product Overview : Human GIMAP7 full-length ORF ( NP_694968.1, 1 a.a. - 300 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 300 amino acids
Description : This gene encodes a protein belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins. In humans, the IAN subfamily genes are located in a cluster at 7q36.1. [provided by RefSeq
Molecular Mass : 60.9 kDa
AA Sequence : MAESEDRSLRIVLVGKTGSGKSATANTILGEEIFDSRIAAQAVTKNCQKASREWQGRDLLVVDTPGLFDTKESLDTTCKEISRCIISSCPGPHAIVLVLLLGRYTEEEQKTVALIKAVFGKSAMKHMVILFTRKEELEGQSFHDFIADADVGLKSIVKECGNRCCAFSNSKKTSKAEKESQVQELVELIEKMVQCNEGAYFSDDIYKDTEERLKQREEVLRKIYTDQLNEEIKLVEEDKHKSEEEKEKEIKLLKLKYDEKIKNIREEAERNIFKDVFNRIWKMLSEIWHRFLSKCKFYSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GIMAP7 GTPase, IMAP family member 7 [ Homo sapiens ]
Official Symbol GIMAP7
Synonyms GIMAP7; GTPase, IMAP family member 7; GTPase IMAP family member 7; IAN7; MGC27027; IAN-7; immune associated nucleotide; immunity-associated nucleotide 7 protein; hIAN7;
Gene ID 168537
mRNA Refseq NM_153236
Protein Refseq NP_694968
MIM 616961
UniProt ID Q8NHV1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GIMAP7 Products

Required fields are marked with *

My Review for All GIMAP7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon