Recombinant Full Length Human GIYD1 Protein, GST-tagged
| Cat.No. : | GIYD1-5288HF |
| Product Overview : | Human GIYD1 full-length ORF ( AAI48778.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 161 amino acids |
| Description : | This gene encodes a protein that is an important regulator of genome stability. The protein represents the catalytic subunit of the SLX1-SLX4 structure-specific endonuclease, which can resolve DNA secondary structures that are formed during repair and recombination processes. Two identical copies of this gene are located on the p arm of chromosome 16 due to a segmental duplication; this record represents the more centromeric copy. Alternative splicing results in multiple transcript variants. Read-through transcription also occurs between this gene and the downstream SULT1A3 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3) gene. [provided by RefSeq, Nov 2010] |
| Molecular Mass : | 44.66 kDa |
| AA Sequence : | MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | SLX1A SLX1 homolog A, structure-specific endonuclease subunit [ Homo sapiens (human) ] |
| Official Symbol | GIYD1 |
| Synonyms | SLX1A; SLX1 homolog A, structure-specific endonuclease subunit; GIYD1; structure-specific endonuclease subunit SLX1; GIY-YIG domain-containing protein 1; SLX1 structure-specific endonuclease subunit homolog A |
| Gene ID | 548593 |
| mRNA Refseq | NM_001014999 |
| Protein Refseq | NP_001014999 |
| MIM | 615822 |
| UniProt ID | Q9BQ83 |
| ◆ Recombinant Proteins | ||
| GIYD1-4919H | Recombinant Human GIYD1 Protein, GST-tagged | +Inquiry |
| GIYD1-5288HF | Recombinant Full Length Human GIYD1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GIYD1 Products
Required fields are marked with *
My Review for All GIYD1 Products
Required fields are marked with *
