Recombinant Human GIYD1 Protein, GST-tagged

• Cat.No.: GIYD1-4919H
• Product Overview: Human GIYD1 full-length ORF ( AAI48778.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a protein that is an important regulator of genome stability. The protein represents the catalytic subunit of the SLX1-SLX4 structure-specific endonuclease, which can resolve DNA secondary structures that are formed during repair and recombination processes. Two identical copies of this gene are located on the p arm of chromosome 16 due to a segmental duplication; this record represents the more centromeric copy. Alternative splicing results in multiple transcript variants. Read-through transcription also occurs between this gene and the downstream SULT1A3 (sulfotransferase family, cytosolic, 1A, phenol-preferring, member 3) gene. [provided by RefSeq, Nov 2010]
• Molecular Mass: 44.66 kDa
• AA Sequence: MGPAGVAARPGRFFGVYLLYCLNPRYRGRVYVGFTVNTARRVQQHNGGRKKGGAWRTSGRGPWEMVLVVHGFPSSVAALRDEEGPLCCPHPGCLLRAHVICLAEEFLQEEPGQLLPLEGQCPCCEKSLLWGDLIWLCQMDTEKEVEDSELEEAHWTDLLET
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: SLX1A SLX1 homolog A, structure-specific endonuclease subunit [ Homo sapiens (human) ]
• Official Symbol: GIYD1
• Synonyms: SLX1A; SLX1 homolog A, structure-specific endonuclease subunit; GIYD1; structure-specific endonuclease subunit SLX1; GIY-YIG domain-containing protein 1; SLX1 structure-specific endonuclease subunit homolog A
• Gene ID: 548593
• mRNA Refseq: NM_001014999
• Protein Refseq: NP_001014999
• MIM: 615822
• UniProt ID: Q9BQ83