Recombinant Full Length Human GJB7 Protein, GST-tagged

• Cat.No.: GJB7-5298HF
• Product Overview: Human GJB7 full-length ORF ( NP_940970.1, 1 a.a. - 223 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 223 amino acids
• Description: Connexins, such as GJB7, are involved in the formation of gap junctions, intercellular conduits that directly connect the cytoplasms of contacting cells. Each gap junction channel is formed by docking of 2 hemichannels, each of which contains 6 connexin subunits (Sohl et al., 2003 [PubMed 12881038]).[supplied by OMIM
• Molecular Mass: 52.3 kDa
• AA Sequence: MSWMFLRDLLSGVNKYSTGTGWIWLAVVFVFRLLVYMVAAEHVWKDEQKEFECNSRQPGCKNVCFDDFFPISQVRLWALQLIMVSTPSLLVVLHVAYHEGREKRHRKKLYVSPGTMDGGLWYAYLISLIVKTGFEIGFLVLFYKLYDGFSVPYLIKCDLKPCPNTVDCFISKPTEKTIFILFLVITSCLCIVLNFIELSFLVLKCFIKCCLQKYLKKPQVLSV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GJB7 gap junction protein beta 7 [ Homo sapiens (human) ]
• Official Symbol: GJB7
• Synonyms: GJB7; gap junction protein beta 7; gap junction beta-7 protein; connexin-25; gap junction protein, beta 7, 25kDa
• Gene ID: 375519
• mRNA Refseq: NM_198568
• Protein Refseq: NP_940970
• MIM: 611921
• UniProt ID: Q6PEY0