Recombinant Full Length Human GKN1 Protein, GST-tagged
Cat.No. : | GKN1-5305HF |
Product Overview : | Human GKN1 full-length ORF ( AAH59778, 21 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 21-185 amino acids |
Description : | The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq |
Molecular Mass : | 43.89 kDa |
AA Sequence : | NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GKN1 gastrokine 1 [ Homo sapiens ] |
Official Symbol | GKN1 |
Synonyms | GKN1; gastrokine 1; gastrokine-1; AMP18; BRICD1; CA11; AMP-18; BRICHOS domain containing 1; 18 kDa antrum mucosa protein; FOV; foveolin; MGC70354; |
Gene ID | 56287 |
mRNA Refseq | NM_019617 |
Protein Refseq | NP_062563 |
MIM | 606402 |
UniProt ID | Q9NS71 |
◆ Recombinant Proteins | ||
GKN1-7831P | Recombinant Pig GKN1 protein, His-tagged | +Inquiry |
GKN1-5643H | Recombinant Human GKN1 protein, His-tagged | +Inquiry |
Gkn1-7830M | Recombinant Mouse Gkn1 protein, His-tagged | +Inquiry |
GKN1-7829H | Recombinant Human GKN1 protein, His & GST-tagged | +Inquiry |
Gkn1-7832R | Recombinant Rat Gkn1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GKN1-001HCL | Recombinant Human GKN1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GKN1 Products
Required fields are marked with *
My Review for All GKN1 Products
Required fields are marked with *
0
Inquiry Basket