Recombinant Full Length Human GKN1 Protein, GST-tagged

• Cat.No.: GKN1-5305HF
• Product Overview: Human GKN1 full-length ORF ( AAH59778, 21 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 21-185 amino acids
• Description: The protein encoded by this gene is found to be down-regulated in human gastric cancer tissue as compared to normal gastric mucosa. [provided by RefSeq
• Molecular Mass: 43.89 kDa
• AA Sequence: NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GKN1 gastrokine 1 [ Homo sapiens ]
• Official Symbol: GKN1
• Synonyms: GKN1; gastrokine 1; gastrokine-1; AMP18; BRICD1; CA11; AMP-18; BRICHOS domain containing 1; 18 kDa antrum mucosa protein; FOV; foveolin; MGC70354
• Gene ID: 56287
• mRNA Refseq: NM_019617
• Protein Refseq: NP_062563
• MIM: 606402
• UniProt ID: Q9NS71