Recombinant Full Length Human GLA Protein, C-Flag-tagged
Cat.No. : | GLA-1628HFL |
Product Overview : | Recombinant Full Length Human GLA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 45.3 kDa |
AA Sequence : | MQLRNPELHLGCALALRFLALVSWDIPGARALDNGLARTPTMGWLHWERFMCNLDCQEEPDSCISEKLFM EMAELMVSEGWKDAGYEYLCIDDCWMAPQRDSEGRLQADPQRFPHGIRQLANYVHSKGLKLGIYADVGNK TCAGFPGSFGYYDIDAQTFADWGVDLLKFDGCYCDSLENLADGYKHMSLALNRTGRSIVYSCEWPLYMWP FQKPNYTEIRQYCNHWRNFADIDDSWKSIKSILDWTSFNQERIVDVAGPGGWNDPDMLVIGNFGLSWNQQ VTQMALWAIMAAPLFMSNDLRHISPQAKALLQDKDVIAINQDPLGKQGYQLRQGDNFEVWERPLSGLAWA VAMINRQEIGGPRSYTIAVASLGKGVACNPACFITQLLPVKRKLGFYEWTSRLRSHINPTGTVLLQLENT MQMSLKDLLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Galactose metabolism, Glycerolipid metabolism, Glycosphingolipid biosynthesis - globo series, Lysosome, Sphingolipid metabolism |
Full Length : | Full L. |
Gene Name | GLA galactosidase alpha [ Homo sapiens (human) ] |
Official Symbol | GLA |
Synonyms | GALA |
Gene ID | 2717 |
mRNA Refseq | NM_000169.3 |
Protein Refseq | NP_000160.1 |
MIM | 300644 |
UniProt ID | P06280 |
◆ Recombinant Proteins | ||
GLA-1509H | Recombinant Human GLA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GLA-5307HF | Recombinant Full Length Human GLA Protein, GST-tagged | +Inquiry |
GLA-2339H | Recombinant Human GLA Protein (Met1-Leu429) | +Inquiry |
GLA-175H | Recombinant Human GLA Protein, His-tagged | +Inquiry |
GLA-983H | Recombinant Human GLA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLA-1521MCL | Recombinant Mouse GLA cell lysate | +Inquiry |
GLA-2173HCL | Recombinant Human GLA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLA Products
Required fields are marked with *
My Review for All GLA Products
Required fields are marked with *
0
Inquiry Basket