Recombinant Full Length Human GLI4 Protein, GST-tagged
| Cat.No. : | GLI4-5329HF |
| Product Overview : | Human GLI4 full-length ORF ( NP_612474.1, 1 a.a. - 376 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 376 amino acids |
| Description : | GLI4 (GLI Family Zinc Finger 4) is a Protein Coding gene. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding. An important paralog of this gene is ZNF696. |
| Molecular Mass : | 67.5 kDa |
| AA Sequence : | MAALGDIQESPSVPSPVSLSSPGTPGTQHHEPQLHLHGHQHGSPGSSPKVLSQPSDLDLQDVEEVEIGRDTFWPDSEPKPEQAPRSPGSQAPDEGAGGALRSLLRSLPRRARCSAGFGPESSAERPAGQPPGAVPCAQPRGAWRVTLVQQAAAGPEGAPERAAELGVNFGRSRQGSARGAKPHRCEACGKSFKYNSLLLKHQRIHTGEKPYACHECGKRFRGWSGFIQHHRIHTGEKPYECGQCGRAFSHSSHFTQHLRIHNGEKPYKCGECGQAFSQSSNLVRHQRLHTGEKPYACSQCGKAFIWSSVLIEHQRIHTGEKPYECSDCGKAFRGRSHFFRHLRTHTGEKPFACGACGKAFGQSSQLIQHQRVHYRE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GLI4 GLI family zinc finger 4 [ Homo sapiens ] |
| Official Symbol | GLI4 |
| Synonyms | GLI4; GLI family zinc finger 4; GLI Kruppel family member GLI4, glioma associated oncogene family zinc finger 4; zinc finger protein GLI4; HKR4; ZNF928; krueppel-related zinc finger protein 4; GLI-Kruppel family member GLI4 (oncogene HKR4); glioma-associated oncogene family zinc finger 4; |
| Gene ID | 2738 |
| mRNA Refseq | NM_138465 |
| Protein Refseq | NP_612474 |
| MIM | 165280 |
| UniProt ID | P10075 |
| ◆ Recombinant Proteins | ||
| GLI4-4957H | Recombinant Human GLI4 Protein, GST-tagged | +Inquiry |
| GLI4-5329HF | Recombinant Full Length Human GLI4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GLI4-710HCL | Recombinant Human GLI4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLI4 Products
Required fields are marked with *
My Review for All GLI4 Products
Required fields are marked with *
