Recombinant Full Length Human GLIS2 Protein, GST-tagged
Cat.No. : | GLIS2-5333HF |
Product Overview : | Human GLIS2 full-length ORF ( AAI46549.1, 1 a.a. - 524 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 524 amino acids |
Description : | Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.[supplied by OMIM |
Molecular Mass : | 84.59 kDa |
AA Sequence : | MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPGSPGSPPSGFLLNSKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLGSGGALHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSGAQIIIPNPAALFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSPFGAGGLGLPVVSLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGLPLLPGTVLDLSTGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GLIS2 GLIS family zinc finger 2 [ Homo sapiens ] |
Official Symbol | GLIS2 |
Synonyms | GLIS2; GLIS family zinc finger 2; zinc finger protein GLIS2; nephrocystin 7; NPHP7; GLI-similar 2; nephrocystin-7; GLI-similar protein 2; neuronal Krueppel-like protein; Kruppel-like zinc finger protein GLIS2; NKL; FLJ38247; |
Gene ID | 84662 |
mRNA Refseq | NM_032575 |
Protein Refseq | NP_115964 |
MIM | 608539 |
UniProt ID | Q9BZE0 |
◆ Recombinant Proteins | ||
GLIS2-3597M | Recombinant Mouse GLIS2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLIS2-295H | Recombinant Human GLIS2 protein, His-tagged | +Inquiry |
GLIS2-4963H | Recombinant Human GLIS2 Protein, GST-tagged | +Inquiry |
GLIS2-5333HF | Recombinant Full Length Human GLIS2 Protein, GST-tagged | +Inquiry |
GLIS2-6409M | Recombinant Mouse GLIS2 Protein | +Inquiry |
◆ Native Proteins | ||
GLIS2-10HFL | Recombinant Full Length Human GLIS2 Protein, His tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLIS2 Products
Required fields are marked with *
My Review for All GLIS2 Products
Required fields are marked with *