Recombinant Full Length Human GLIS2 Protein, GST-tagged

Cat.No. : GLIS2-5333HF
Product Overview : Human GLIS2 full-length ORF ( AAI46549.1, 1 a.a. - 524 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 524 amino acids
Description : Members of the Kruppel-like zinc finger protein family, such as GLIS2, function as activators and/or repressors of gene transcription.[supplied by OMIM
Molecular Mass : 84.59 kDa
AA Sequence : MHSLDEPLDLKLSITKLRAAREKRERTLGVVRPRALHRELGLVDDSPTPGSPGSPPSGFLLNSKFPEKVEGRFSAAPLVDLSLSPPSGLDSPNGSSSLSPERQGNGDLPPVPSASDFQPLRYLDGVPSSFQFFLPLGSGGALHLPASSFLTPPKDKCLSPDLPLPKQLVCRWAKCNQLFELLQDLVDHVNDYHVKPEKDAGYCCHWEGCARHGRGFNARYKMLIHIRTHTNEKPHRCPTCSKSFSRLENLKIHNRSHTGEKPYVCPYEGCNKRYSNSSDRFKHTRTHYVDKPYYCKMPGCHKRYTDPSSLRKHIKAHGHFVSHEQQELLQLRPPPKPPLPAPDGGPYVSGAQIIIPNPAALFGGPGLPGLPLPLAPGPLDLSALACGNGGGSGGGGGMGPGLPGPVLPLNLAKNPLLPSPFGAGGLGLPVVSLLAGAAGGKAEGEKGRGSVPTRALGMEGHKTPLERTESSCSRPSPDGLPLLPGTVLDLSTGVNSAASSPEALAPGWVVIPPGSVLLKPAVVN
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GLIS2 GLIS family zinc finger 2 [ Homo sapiens ]
Official Symbol GLIS2
Synonyms GLIS2; GLIS family zinc finger 2; zinc finger protein GLIS2; nephrocystin 7; NPHP7; GLI-similar 2; nephrocystin-7; GLI-similar protein 2; neuronal Krueppel-like protein; Kruppel-like zinc finger protein GLIS2; NKL; FLJ38247;
Gene ID 84662
mRNA Refseq NM_032575
Protein Refseq NP_115964
MIM 608539
UniProt ID Q9BZE0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GLIS2 Products

Required fields are marked with *

My Review for All GLIS2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon