Recombinant Full Length Human GLRX3 Protein, C-Flag-tagged
Cat.No. : | GLRX3-1401HFL |
Product Overview : | Recombinant Full Length Human GLRX3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the glutaredoxin family. Glutaredoxins are oxidoreductase enzymes that reduce a variety of substrates using glutathione as a cofactor. The encoded protein binds to and modulates the function of protein kinase C theta. The encoded protein may also inhibit apoptosis and play a role in cellular growth, and the expression of this gene may be a marker for cancer. Pseudogenes of this gene are located on the short arm of chromosomes 6 and 9. Alternatively spliced transcript variants have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 37.3 kDa |
AA Sequence : | MAAGAAEAAVAAVEEVGSAGQFEELLRLKAKSLLVVHFWAPWAPQCAQMNEVMAELAKELPQVSFVKLEA EGVPEVSEKYEISSVPTFLFFKNSQKIDRLDGAHAPELTKKVQRHASSGSFLPSANEHLKEDLNLRLKKL THAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKAYSSWPTYPQLYVSGELI GGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYET FDILEDEEVRQGLKAYSNWPTYPQLYVKGELVGGLDIVKELKENGELLPILRGENTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | GLRX3 glutaredoxin 3 [ Homo sapiens (human) ] |
Official Symbol | GLRX3 |
Synonyms | GRX3; GRX4; GLRX4; PICOT; TXNL2; TXNL3 |
Gene ID | 10539 |
mRNA Refseq | NM_006541.5 |
Protein Refseq | NP_006532.2 |
MIM | 612754 |
UniProt ID | O76003 |
◆ Recombinant Proteins | ||
GLRX3-1401HFL | Recombinant Full Length Human GLRX3 Protein, C-Flag-tagged | +Inquiry |
Glrx3-629M | Recombinant Mouse Glrx3 Protein, His-tagged | +Inquiry |
GLRX3-13313H | Recombinant Human GLRX3, GST-tagged | +Inquiry |
GLRX3-3603M | Recombinant Mouse GLRX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
GLRX3-2405H | Recombinant Human Glutaredoxin 3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLRX3-5897HCL | Recombinant Human GLRX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GLRX3 Products
Required fields are marked with *
My Review for All GLRX3 Products
Required fields are marked with *
0
Inquiry Basket