Recombinant Full Length Human GM2A Protein, GST-tagged
Cat.No. : | GM2A-5366HF |
Product Overview : | Human GM2A full-length ORF ( NP_000396.2, 1 a.a. - 193 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 193 amino acids |
Description : | This gene encodes a small glycolipid transport protein which acts as a substrate specific co-factor for the lysosomal enzyme beta-hexosaminidase A. Beta-hexosaminidase A, together with GM2 ganglioside activator, catalyzes the degradation of the ganglioside GM2, and other molecules containing terminal N-acetyl hexosamines. Mutations in this gene result in GM2-gangliosidosis type AB or the AB variant of Tay-Sachs disease. [provided by RefSeq |
Molecular Mass : | 47.2 kDa |
AA Sequence : | MQSLMQAPLLIALGLLLAAPAQAHLKKPSQLSSFSWDNCDEGKDPAVIRSLTLEPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAASLKGI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GM2A GM2 ganglioside activator [ Homo sapiens ] |
Official Symbol | GM2A |
Synonyms | GM2A; GM2 ganglioside activator; GM2 ganglioside activator protein; ganglioside GM2 activator; cerebroside sulfate activator protein; SAP 3; sphingolipid activator protein 3; shingolipid activator protein 3; SAP-3; GM2-AP; |
Gene ID | 2760 |
mRNA Refseq | NM_000405 |
Protein Refseq | NP_000396 |
MIM | 613109 |
UniProt ID | P17900 |
◆ Recombinant Proteins | ||
GM2A-2973H | Recombinant Human GM2A protein, GST-tagged | +Inquiry |
GM2A-5366HF | Recombinant Full Length Human GM2A Protein, GST-tagged | +Inquiry |
GM2A-554C | Recombinant Cynomolgus GM2A Protein, His-tagged | +Inquiry |
GM2A-556H | Recombinant Human GM2A protein, His-tagged | +Inquiry |
GM2A-2400H | Recombinant Human GM2A Protein (Ser32-Ile193), C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GM2A-450HCL | Recombinant Human GM2A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GM2A Products
Required fields are marked with *
My Review for All GM2A Products
Required fields are marked with *
0
Inquiry Basket