Recombinant Full Length Human GNA11 Protein, C-Flag-tagged
Cat.No. : | GNA11-1479HFL |
Product Overview : | Recombinant Full Length Human GNA11 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.9 kDa |
AA Sequence : | MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEE DKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPG IQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQR SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE DKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ LNLKEYNLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Calcium signaling pathway, Gap junction, GnRH signaling pathway, Long-term depression, Vascular smooth muscle contraction |
Full Length : | Full L. |
Gene Name | GNA11 G protein subunit alpha 11 [ Homo sapiens (human) ] |
Official Symbol | GNA11 |
Synonyms | FBH; FBH2; FHH2; HG1K; HHC2; GNA-11; HYPOC2 |
Gene ID | 2767 |
mRNA Refseq | NM_002067.5 |
Protein Refseq | NP_002058.2 |
MIM | 139313 |
UniProt ID | P29992 |
◆ Recombinant Proteins | ||
GNA11-1479HFL | Recombinant Full Length Human GNA11 Protein, C-Flag-tagged | +Inquiry |
GNA11-13342H | Recombinant Human GNA11, His-tagged | +Inquiry |
GNA11-1709R | Recombinant Rhesus Macaque GNA11 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gna11-3253M | Recombinant Mouse Gna11 Protein, Myc/DDK-tagged | +Inquiry |
GNA11-3051H | Recombinant Human GNA11 Protein (Met1-Val359), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNA11-5872HCL | Recombinant Human GNA11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNA11 Products
Required fields are marked with *
My Review for All GNA11 Products
Required fields are marked with *
0
Inquiry Basket