Recombinant Full Length Human GNAO1 Protein, C-Flag-tagged
Cat.No. : | GNAO1-1523HFL |
Product Overview : | Recombinant Full Length Human GNAO1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene represents the alpha subunit of the Go heterotrimeric G-protein signal-transducing complex. Defects in this gene are a cause of early-onset epileptic encephalopathy. Two transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.9 kDa |
AA Sequence : | MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYK PVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQEC FNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERK KWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLKLFDSICNNKWFTDTSIILFLNKKDIFEEKIK KSPLTICFPEYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRG CGLYTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Long-term depression, Melanogenesis |
Full Length : | Full L. |
Gene Name | GNAO1 G protein subunit alpha o1 [ Homo sapiens (human) ] |
Official Symbol | GNAO1 |
Synonyms | GNAO; HG1G; DEE17; NEDIM; EIEE17; HLA-DQB1; G-ALPHA-o |
Gene ID | 2775 |
mRNA Refseq | NM_138736.3 |
Protein Refseq | NP_620073.2 |
MIM | 139311 |
UniProt ID | P09471 |
◆ Recombinant Proteins | ||
GNAO1-1400M | Recombinant Mouse GNAO1 Protein (2-354 aa), His-tagged | +Inquiry |
GNAO1-13349H | Recombinant Human GNAO1, GST-tagged | +Inquiry |
GNAO1-2596R | Recombinant Rat GNAO1 Protein | +Inquiry |
Gnao1-3257M | Recombinant Mouse Gnao1 Protein, Myc/DDK-tagged | +Inquiry |
GNAO1-997H | Recombinant Human GNAO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAO1-5868HCL | Recombinant Human GNAO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNAO1 Products
Required fields are marked with *
My Review for All GNAO1 Products
Required fields are marked with *
0
Inquiry Basket