Recombinant Human GNAO1, His-tagged
Cat.No. : | GNAO1-28088TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 8-329 of Human G0 Protein alpha with N terminal His tag, 322 amino acids, 37kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 8-329 a.a. |
Conjugation : | HIS |
Form : | Lyophilised:Reconstitute with 133 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | EERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKS TIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIV RAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAE LLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLD RIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRL FDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHE DETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSP NKEIYCHMTCATDT |
Sequence Similarities : | Belongs to the G-alpha family. G(i/o/t/z) subfamily. |
Gene Name | GNAO1 guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O [ Homo sapiens ] |
Official Symbol | GNAO1 |
Synonyms | GNAO1; guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O; guanine nucleotide-binding protein G(o) subunit alpha; G ALPHA o; |
Gene ID | 2775 |
mRNA Refseq | NM_020988 |
Protein Refseq | NP_066268 |
MIM | 139311 |
Uniprot ID | P09471 |
Chromosome Location | 16q13 |
Pathway | Calcium Regulation in the Cardiac Cell, organism-specific biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Cholinergic synapse, organism-specific biosystem; Dopaminergic synapse, organism-specific biosystem; |
Function | G-protein beta/gamma-subunit complex binding; GTP binding; GTPase activity; guanyl nucleotide binding; metabotropic serotonin receptor binding; |
◆ Recombinant Proteins | ||
GNAO1-28088TH | Recombinant Human GNAO1, His-tagged | +Inquiry |
GNAO1-1893R | Recombinant Rhesus monkey GNAO1 Protein, His-tagged | +Inquiry |
Gnao1-5417M | Recombinant Mouse Gnao1 protein | +Inquiry |
GNAO1-2251R | Recombinant Rat GNAO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNAO1-13349H | Recombinant Human GNAO1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAO1-5868HCL | Recombinant Human GNAO1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNAO1 Products
Required fields are marked with *
My Review for All GNAO1 Products
Required fields are marked with *