Recombinant Full Length Human GNAT2 Protein, GST-tagged
Cat.No. : | GNAT2-5337HF |
Product Overview : | Human GNAT2 full-length ORF ( NP_005263.1, 1 a.a. - 354 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 354 amino acids |
Description : | Transducin is a 3-subunit guanine nucleotide-binding protein (G protein) which stimulates the coupling of rhodopsin and cGMP-phoshodiesterase during visual impulses. The transducin alpha subunits in rods and cones are encoded by separate genes. This gene encodes the alpha subunit in cones. [provided by RefSeq |
Molecular Mass : | 66.6 kDa |
AA Sequence : | MGSGASAEDKELAKRSKELEKKLQEDADKEAKTVKLLLLGAGESGKSTIVKQMKIIHQDGYSPEECLEFKAIIYGNVLQSILAIIRAMTTLGIDYAEPSCADDGRQLNNLADSIEEGTMPPELVEVIRRLWKDGGVQACFERAAEYQLNDSASYYLNQLERITDPEYLPSEQDVLRSRVKTTGIIETKFSVKDLNFRMFDVGGQRSERKKWIHCFEGVTCIIFCAALSAYDMVLVEDDEVNRMHESLHLFNSICNHKFFAATSIVLFLNKKDLFEEKIKKVHLSICFPEYDGNNSYDDAGNYIKSQFLDLNMRKDVKEIYSHMTCATDTQNVKFVFDAVTDIIIKENLKDCGLF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNAT2 guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2 [ Homo sapiens ] |
Official Symbol | GNAT2 |
Synonyms | GNAT2; guanine nucleotide binding protein (G protein), alpha transducing activity polypeptide 2; guanine nucleotide-binding protein G(t) subunit alpha-2; ACHM4; transducin alpha-2 chain; cone-type transducin alpha subunit; transducin, cone-specific, alpha polypeptide; GNATC; |
Gene ID | 2780 |
mRNA Refseq | NM_005272 |
Protein Refseq | NP_005263 |
MIM | 139340 |
UniProt ID | P19087 |
◆ Recombinant Proteins | ||
GNAT2-6256C | Recombinant Chicken GNAT2 | +Inquiry |
GNAT2-3046H | Recombinant Human GNAT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNAT2-5049H | Recombinant Human GNAT2 Protein, GST-tagged | +Inquiry |
GNAT2-5337HF | Recombinant Full Length Human GNAT2 Protein, GST-tagged | +Inquiry |
Gnat2-1029M | Recombinant Mouse Gnat2 Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAT2-5865HCL | Recombinant Human GNAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNAT2 Products
Required fields are marked with *
My Review for All GNAT2 Products
Required fields are marked with *