Recombinant Full Length Human GNB4 Protein, His-tagged
| Cat.No. : | GNB4-13358H |
| Product Overview : | Recombinant Full Length Human GNB4 Protein(1-340 aa), fused with N-terminal His tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-340 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MSELEQLRQEAEQLRNQIQDARKACNDATLVQITSNMDSVGRIQMRTRRTLRGHLAKIYAMHWGYDSRLLVSASQDGKLIIWDSYTTNKMHAIPLRSSWVMTCAYAPSGNYVACGGLDNICSIYNLKTREGNVRVSRELPGHTGYLSCCRFLDDSQIVTSSGDTTCALWDIETAQQTTTFTGHSGDVMSLSLSPDMRTFVSGACDASSKLWDIRDGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLYSHDNIICGITSVAFSKSGRLLLAGYDDFNCNVWDTLKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLRIWN |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | GNB4 guanine nucleotide binding protein (G protein), beta polypeptide 4 [ Homo sapiens ] |
| Official Symbol | GNB4 |
| Synonyms | GNB4; guanine nucleotide binding protein (G protein), beta polypeptide 4; guanine nucleotide-binding protein subunit beta-4; transducin beta chain 4; G protein beta-4 subunit; guanine nucleotide binding protein beta subunit 4; |
| Gene ID | 59345 |
| mRNA Refseq | NM_021629 |
| Protein Refseq | NP_067642 |
| MIM | 610863 |
| UniProt ID | Q9HAV0 |
| ◆ Recombinant Proteins | ||
| GNB4-1719R | Recombinant Rhesus Macaque GNB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| GNB4-7030M | Recombinant Mouse GNB4 Protein | +Inquiry |
| GNB4-2603R | Recombinant Rat GNB4 Protein | +Inquiry |
| GNB4-1537H | Recombinant Human GNB4, T7-tagged | +Inquiry |
| GNB4-2258R | Recombinant Rat GNB4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNB4-5860HCL | Recombinant Human GNB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNB4 Products
Required fields are marked with *
My Review for All GNB4 Products
Required fields are marked with *



