Recombinant Full Length Human GNB5 Protein, GST-tagged
Cat.No. : | GNB5-5372HF |
Product Overview : | Human GNB5 full-length ORF ( AAH11671, 1 a.a. - 126 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 126 amino acids |
Description : | Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. Alternatively spliced transcript variants encoding different isoforms exist. [provided by RefSeq |
Molecular Mass : | 39.6 kDa |
AA Sequence : | MATEGLHENETLASLKSEAESLKGKLEEERAKLHDVELHQVAERVEALGQFVMKTRRTLKGHGNKVLCMDWCKDKRRIVSSSQDGKVIVWDSFTTNKVRHCSQPRYRGFRIPAYLKVLWSSCPALS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNB5 guanine nucleotide binding protein (G protein), beta 5 [ Homo sapiens ] |
Official Symbol | GNB5 |
Synonyms | GNB5; guanine nucleotide binding protein (G protein), beta 5; guanine nucleotide-binding protein subunit beta-5; GB5; gbeta5; transducin beta chain 5; G protein, beta-5 subunit; G protein, beta subunit 5L; guanine nucleotide-binding protein, beta subunit 5L; FLJ37457; FLJ43714; |
Gene ID | 10681 |
mRNA Refseq | NM_006578 |
Protein Refseq | NP_006569 |
MIM | 604447 |
UniProt ID | O14775 |
◆ Recombinant Proteins | ||
GNB5-5372HF | Recombinant Full Length Human GNB5 Protein, GST-tagged | +Inquiry |
GNB5-3769M | Recombinant Mouse GNB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNB5-2978H | Recombinant Human GNB5 protein, His-SUMO-tagged | +Inquiry |
GNB5-5563C | Recombinant Chicken GNB5 | +Inquiry |
GNB5-5058H | Recombinant Human GNB5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNB5-5859HCL | Recombinant Human GNB5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNB5 Products
Required fields are marked with *
My Review for All GNB5 Products
Required fields are marked with *
0
Inquiry Basket