Recombinant Full Length Human GNG10 Protein, GST-tagged

Cat.No. : GNG10-5384HF
Product Overview : Human GNG10 full-length ORF ( NP_001017998.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 68 amino acids
Description : GNG10 (G Protein Subunit Gamma 10) is a Protein Coding gene. Among its related pathways are Aquaporin-mediated transport and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include GTPase activity and signal transducer activity. An important paralog of this gene is GNG2.
Molecular Mass : 33.6 kDa
AA Sequence : MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GNG10 G protein subunit gamma 10 [ Homo sapiens (human) ]
Official Symbol GNG10
Synonyms GNG10 G; protein subunit gamma 10; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10; guanine nucleotide binding protein (G protein), gamma 10; guanine nucleotide binding protein 10
Gene ID 2790
mRNA Refseq NM_001017998
Protein Refseq NP_001017998
MIM 604389
UniProt ID P50151

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GNG10 Products

Required fields are marked with *

My Review for All GNG10 Products

Required fields are marked with *

0
cart-icon