Recombinant Human GNG10 Protein, GST-tagged
| Cat.No. : | GNG10-5063H |
| Product Overview : | Human GNG10 full-length ORF ( NP_001017998.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | GNG10 (G Protein Subunit Gamma 10) is a Protein Coding gene. Among its related pathways are Aquaporin-mediated transport and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include GTPase activity and signal transducer activity. An important paralog of this gene is GNG2. |
| Molecular Mass : | 33.6 kDa |
| AA Sequence : | MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GNG10 G protein subunit gamma 10 [ Homo sapiens (human) ] |
| Official Symbol | GNG10 |
| Synonyms | GNG10 G; protein subunit gamma 10; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10; guanine nucleotide binding protein (G protein), gamma 10; guanine nucleotide binding protein 10 |
| Gene ID | 2790 |
| mRNA Refseq | NM_001017998 |
| Protein Refseq | NP_001017998 |
| MIM | 604389 |
| UniProt ID | P50151 |
| ◆ Recombinant Proteins | ||
| GNG10-5384HF | Recombinant Full Length Human GNG10 Protein, GST-tagged | +Inquiry |
| Gng10-1032M | Recombinant Mouse Gng10 Protein, MYC/DDK-tagged | +Inquiry |
| GNG10-8020Z | Recombinant Zebrafish GNG10 | +Inquiry |
| GNG10-1900R | Recombinant Rhesus monkey GNG10 Protein, His-tagged | +Inquiry |
| GNG10-3047H | Recombinant Human GNG10 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GNG10-5857HCL | Recombinant Human GNG10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNG10 Products
Required fields are marked with *
My Review for All GNG10 Products
Required fields are marked with *
