Recombinant Human GNG10 Protein, GST-tagged
Cat.No. : | GNG10-5063H |
Product Overview : | Human GNG10 full-length ORF ( NP_001017998.1, 1 a.a. - 68 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | GNG10 (G Protein Subunit Gamma 10) is a Protein Coding gene. Among its related pathways are Aquaporin-mediated transport and Immune response CCR3 signaling in eosinophils. GO annotations related to this gene include GTPase activity and signal transducer activity. An important paralog of this gene is GNG2. |
Molecular Mass : | 33.6 kDa |
AA Sequence : | MSSGASASALQRLVEQLKLEAGVERIKVSQAAAELQQYCMQNACKDALLVGVPAGSNPFREPRSCALL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNG10 G protein subunit gamma 10 [ Homo sapiens (human) ] |
Official Symbol | GNG10 |
Synonyms | GNG10 G; protein subunit gamma 10; guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-10; guanine nucleotide binding protein (G protein), gamma 10; guanine nucleotide binding protein 10 |
Gene ID | 2790 |
mRNA Refseq | NM_001017998 |
Protein Refseq | NP_001017998 |
MIM | 604389 |
UniProt ID | P50151 |
◆ Recombinant Proteins | ||
GNG10-5063H | Recombinant Human GNG10 Protein, GST-tagged | +Inquiry |
GNG10-8020Z | Recombinant Zebrafish GNG10 | +Inquiry |
GNG10-695H | Recombinant Human GNG10 | +Inquiry |
GNG10-6621H | Recombinant Human GNG10 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNG10-5384HF | Recombinant Full Length Human GNG10 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNG10-5857HCL | Recombinant Human GNG10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNG10 Products
Required fields are marked with *
My Review for All GNG10 Products
Required fields are marked with *
0
Inquiry Basket