Recombinant Full Length Human GNG12 Protein, C-Flag-tagged

• Cat.No.: GNG12-2115HFL
• Product Overview: Recombinant Full Length Human GNG12 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: Enables PDZ domain binding activity. Predicted to be involved in G protein-coupled receptor signaling pathway. Located in extracellular exosome.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 7.8 kDa
• AA Sequence: MSSKTASTNNIAQARRTVQQLRLEASIEGIKVSKASADLMSYCEEHARSDPLLIGIPTSENPFKDKKTCI IL myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Protein Pathways: Chemokine signaling pathway, MAPK signaling pathway, Regulation of actin cytoskeleton
• Full Length: Full L.

Gene Information

• Gene Name: GNG12 G protein subunit gamma 12 [ Homo sapiens (human) ]
• Official Symbol: GNG12
• Synonyms: HG3A
• Gene ID: 55970
• mRNA Refseq: NM_018841.6
• Protein Refseq: NP_061329.3
• MIM: 615405
• UniProt ID: Q9UBI6