Recombinant Full Length Human GNLY Protein, C-Flag-tagged
| Cat.No. : | GNLY-1702HFL |
| Product Overview : | Recombinant Full Length Human GNLY Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 16.2 kDa |
| AA Sequence : | MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP STGPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Secreted Protein |
| Full Length : | Full L. |
| Gene Name | GNLY granulysin [ Homo sapiens (human) ] |
| Official Symbol | GNLY |
| Synonyms | LAG2; NKG5; LAG-2; D2S69E; TLA519 |
| Gene ID | 10578 |
| mRNA Refseq | NM_006433.5 |
| Protein Refseq | NP_006424.2 |
| MIM | 188855 |
| UniProt ID | P22749 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNLY Products
Required fields are marked with *
My Review for All GNLY Products
Required fields are marked with *




