Recombinant Full Length Human GNLY Protein, C-Flag-tagged

Species :	Human
Source :	Mammalian Cells
Tag :	Flag
Description :	The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified.
Form :	25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass :	16.2 kDa
AA Sequence :	MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP STGPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity :	> 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability :	Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage :	Store at -80 centigrade.
Concentration :	>50 ug/mL as determined by microplate BCA method.
Preparation :	Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families :	Secreted Protein
Full Length :	Full L.

Gene Name	GNLY granulysin [ Homo sapiens (human) ]
Official Symbol	GNLY
Synonyms	LAG2; NKG5; LAG-2; D2S69E; TLA519
Gene ID	10578
mRNA Refseq	NM_006433.5
Protein Refseq	NP_006424.2
MIM	188855
UniProt ID	P22749