Recombinant Full Length Human GNPNAT1 Protein, GST-tagged
| Cat.No. : | GNPNAT1-5404HF | 
| Product Overview : | Human GNPNAT1 full-length ORF ( NP_932332.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 184 amino acids | 
| Description : | GNPNAT1 (Glucosamine-Phosphate N-Acetyltransferase 1) is a Protein Coding gene. Among its related pathways are Amino sugar and nucleotide sugar metabolism and Synthesis of substrates in N-glycan biosythesis. GO annotations related to this gene include identical protein binding and monosaccharide binding. | 
| Molecular Mass : | 47.1 kDa | 
| AA Sequence : | MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | GNPNAT1 glucosamine-phosphate N-acetyltransferase 1 [ Homo sapiens ] | 
| Official Symbol | GNPNAT1 | 
| Synonyms | GNPNAT1; glucosamine-phosphate N-acetyltransferase 1; glucosamine 6-phosphate N-acetyltransferase; FLJ10607; Gpnat1; phosphoglucosamine acetylase; phosphoglucosamine transacetylase; GNPNAT; | 
| Gene ID | 64841 | 
| mRNA Refseq | NM_198066 | 
| Protein Refseq | NP_932332 | 
| MIM | 616510 | 
| UniProt ID | Q96EK6 | 
| ◆ Recombinant Proteins | ||
| GNPNAT1-6421H | Recombinant Human GNPNAT1 protein, His-tagged | +Inquiry | 
| GNPNAT1-26420TH | Recombinant Human GNPNAT1, His-tagged | +Inquiry | 
| GNPNAT1-5093H | Recombinant Human GNPNAT1 Protein, GST-tagged | +Inquiry | 
| GNPNAT1-13377H | Recombinant Human GNPNAT1, His-tagged | +Inquiry | 
| GNPNAT1-933H | Recombinant Human GNPNAT1, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| GNPNAT1-5841HCL | Recombinant Human GNPNAT1 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNPNAT1 Products
Required fields are marked with *
My Review for All GNPNAT1 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            