Recombinant Full Length Human GNPNAT1 Protein, GST-tagged
Cat.No. : | GNPNAT1-5404HF |
Product Overview : | Human GNPNAT1 full-length ORF ( NP_932332.1, 1 a.a. - 184 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 184 amino acids |
Description : | GNPNAT1 (Glucosamine-Phosphate N-Acetyltransferase 1) is a Protein Coding gene. Among its related pathways are Amino sugar and nucleotide sugar metabolism and Synthesis of substrates in N-glycan biosythesis. GO annotations related to this gene include identical protein binding and monosaccharide binding. |
Molecular Mass : | 47.1 kDa |
AA Sequence : | MKPDETPMFDPSLLKEVDWSQNTATFSPAISPTHPGEGLVLRPLCTADLNRGFFKVLGQLTETGVVSPEQFMKSFEHMKKSGDYYVTVVEDVTLGQIVATATLIIEHKFIHSCAKRGRVEDVVVSDECRGKQLGKLLLSTLTLLSKKLNCYKITLECLPQNVGFYKKFGYTVSEENYMCRRFLK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNPNAT1 glucosamine-phosphate N-acetyltransferase 1 [ Homo sapiens ] |
Official Symbol | GNPNAT1 |
Synonyms | GNPNAT1; glucosamine-phosphate N-acetyltransferase 1; glucosamine 6-phosphate N-acetyltransferase; FLJ10607; Gpnat1; phosphoglucosamine acetylase; phosphoglucosamine transacetylase; GNPNAT; |
Gene ID | 64841 |
mRNA Refseq | NM_198066 |
Protein Refseq | NP_932332 |
MIM | 616510 |
UniProt ID | Q96EK6 |
◆ Recombinant Proteins | ||
GNPNAT1-13377H | Recombinant Human GNPNAT1, His-tagged | +Inquiry |
GNPNAT1-1734R | Recombinant Rhesus Macaque GNPNAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GNPNAT1-26420TH | Recombinant Human GNPNAT1, His-tagged | +Inquiry |
GNPNAT1-1914R | Recombinant Rhesus monkey GNPNAT1 Protein, His-tagged | +Inquiry |
GNPNAT1-3784M | Recombinant Mouse GNPNAT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPNAT1-5841HCL | Recombinant Human GNPNAT1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNPNAT1 Products
Required fields are marked with *
My Review for All GNPNAT1 Products
Required fields are marked with *
0
Inquiry Basket