Recombinant Full Length Human GNPTG Protein, GST-tagged
Cat.No. : | GNPTG-5406HF |
Product Overview : | Human GNPTG full-length ORF ( AAH14592, 19 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 19-304 amino acids |
Description : | UDP-N-acetylglucosamine:lysosomal-enzyme N-acetylglucosamine-1-phosphotransferase (GlcNAc-phosphotransferase) catalyzes the initial step in the synthesis of the mannose 6-phosphate determinant required for efficient intracellular targeting of newly synthesized lysosomal hydrolases to the lysosome. GlcNAc-phosphotransferase is an alpha-2/beta-2/gamma-2 hexameric complex, the enzyme product of 2 genes, 1 encoded by a gene on chromosome 16 (GNPTG) and the other by a gene on chromosome 12 (GNPTAB; MIM 607840).[supplied by OMIM |
Molecular Mass : | 57.2 kDa |
AA Sequence : | PAPAGAAKMKVVEEPNAFGVNNPFLPQASRLQAKRDPSPVSGPVHLFRLSGKCFSLVESTYKYEFCPFHNVTQHEQTFRWNAYSGILGIWHEWEIANNTFTGMWMRDGDACRSRSRQSKVELACGKSNRLAHVSEPSTCVYALTFETPLVCHPHALLVYPTLPEALQRQWDRVEQDLADELITPQGHEKLLRTLFEDAGYLKTPENEPTQLEGGPDSLGFETLENCRKAHKELSKEIKRLKGLLTQHGIPYTRPTETSNLEHLGHETPRAKSPEQLRGDPGLRGSL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNPTG N-acetylglucosamine-1-phosphate transferase, gamma subunit [ Homo sapiens ] |
Official Symbol | GNPTG |
Synonyms | GNPTG; N-acetylglucosamine-1-phosphate transferase, gamma subunit; C16orf27, chromosome 16 open reading frame 27, GNPTAG, N acetylglucosamine 1 phosphotransferase, gamma subunit; N-acetylglucosamine-1-phosphotransferase subunit gamma; c316G12.3; CAB56184; GlcNAc phosphotransferase gamma subunit; glcNAc-1-phosphotransferase subunit gamma; UDP-N-acetylglucosamine-1-phosphotransferase subunit gamma; RJD9; GNPTAG; LP2537; C16orf27; |
Gene ID | 84572 |
mRNA Refseq | NM_032520 |
Protein Refseq | NP_115909 |
MIM | 607838 |
UniProt ID | Q9UJJ9 |
◆ Recombinant Proteins | ||
GNPTG-5153H | Recombinant Human GNPTG Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GNPTG-291Z | Recombinant Zebrafish GNPTG | +Inquiry |
GNPTG-7054M | Recombinant Mouse GNPTG Protein | +Inquiry |
GNPTG-13379H | Recombinant Human GNPTG, His-tagged | +Inquiry |
Gnptg-3266M | Recombinant Mouse Gnptg Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNPTG-5840HCL | Recombinant Human GNPTG 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GNPTG Products
Required fields are marked with *
My Review for All GNPTG Products
Required fields are marked with *
0
Inquiry Basket