Recombinant Full Length Human GPANK1 Protein, C-Flag-tagged
Cat.No. : | GPANK1-1368HFL |
Product Overview : | Recombinant Full Length Human GPANK1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is located in a cluster of HLA-B-associated transcripts, which is included in the human major histocompatability complex III region. This gene encodes a protein which is thought to play a role in immunity. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 39.1 kDa |
AA Sequence : | MSRPLLITFTPATDPSDLWKDGQQQPQPEKPESTLDGAAARAFYEALIGDESSAPDSQRSQTEPARERKR KKRRIMKAPAAEAVAEGASGRHGQGRSLEAEDKMTHRILRAAQEGDLPELRRLLEPHEAGGAGGNINARD AFWWTPLMCAARAGQGAAVSYLLGRGAAWVGVCELSGRDAAQLAEEAGFPEVARMVRESHGETRSPENRS PTPSLQYCENCDTHFQDSNHRTSTAHLLSLSQGPQPPNLPLGVPISSPGFKLLLRGGWEPGMGLGPRGEG RANPIPTVLKRDQEGLGYRSAPQPRVTHFPAWDTRAVAGRERPPRVATLSWREERRREEKDRAWERDLRT YMNLEFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | GPANK1 G-patch domain and ankyrin repeats 1 [ Homo sapiens (human) ] |
Official Symbol | GPANK1 |
Synonyms | G5; BAT4; D6S54E; ANKRD59; GPATCH10 |
Gene ID | 7918 |
mRNA Refseq | NM_033177.4 |
Protein Refseq | NP_149417.1 |
MIM | 142610 |
UniProt ID | O95872 |
◆ Recombinant Proteins | ||
GPANK1-1007H | Recombinant Human GPANK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPANK1-1833HF | Recombinant Full Length Human GPANK1 Protein, GST-tagged | +Inquiry |
GPANK1-7089M | Recombinant Mouse GPANK1 Protein | +Inquiry |
GPANK1-3813M | Recombinant Mouse GPANK1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPANK1-1368HFL | Recombinant Full Length Human GPANK1 Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPANK1-8508HCL | Recombinant Human BAT4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPANK1 Products
Required fields are marked with *
My Review for All GPANK1 Products
Required fields are marked with *
0
Inquiry Basket