Recombinant Full Length Human GPER Protein
| Cat.No. : | GPER-5528HF |
| Product Overview : | Human GPER full-length ORF (NP_001496.1) recombinant protein without tag. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Protein Length : | 396 amino acids |
| Description : | This gene is a member of the G-protein coupled receptor 1 family and encodes a multi-pass membrane protein that localizes to the endoplasmic reticulum. The protein binds estrogen, resulting in intracellular calcium mobilization and synthesis of phosphatidylinositol 3,4,5-trisphosphate in the nucleus. This protein therefore plays a role in the rapid nongenomic signaling events widely observed following stimulation of cells and tissues with estrogen. Alternate transcriptional splice variants which encode the same protein have been characterized. [provided by RefSeq |
| Form : | Liquid |
| Molecular Mass : | 42.2 kDa |
| AA Sequence : | MDVTSQARGVGLEMYPGTAQPAAPNTTSPELNLSHPLLGTALANGTGELSEHQQYVIGLFLSCLYTIFLFPIGFVGNILILVVNISFREKMTIPDLYFINLAVADLILVADSLIEVFNLHERYYDIAVLCTFMSLFLQVNMYSSVFFLTWMSFDRYIALARAMRCSLFRTKHHARLSCGLIWMASVSATLVPFTAVHLQHTDEACFCFADVREVQWLEVTLGFIVPFAIIGLCYSLIVRVLVRAHRHRGLRPRRQKALRMILAVVLVFFVCWLPENVFISVHLLQRTQPGAAPCKQSFRHAHPLTGHIVNLAAFSNSCLNPLIYSFLGETFRDKLRLYIEQKTNLPALNRFCHAALKAVIPDSTEQSDVRFSSAV |
| Applications : | Antibody Production Functional Study Compound Screening |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
| Gene Name | GPER G protein-coupled estrogen receptor 1 [ Homo sapiens ] |
| Official Symbol | GPER |
| Synonyms | GPER; G protein-coupled estrogen receptor 1; CMKRL2, G protein coupled receptor 30, GPR30; G-protein coupled estrogen receptor 1; CEPR; DRY12; FEG 1; GPCR Br; LERGU; LERGU2; LyGPR; mER; heptahelix receptor; chemokine receptor-like 2; IL8-related receptor DRY12; membrane estrogen receptor; G protein-coupled receptor 30; G-protein coupled receptor 30; chemoattractant receptor-like 2; leucine rich protein in GPR30 3UTR; lymphocyte-derived G-protein coupled receptor; constitutively expressed peptide-like receptor; flow-induced endothelial G-protein coupled receptor 1; FEG-1; GPR30; CMKRL2; GPCR-Br; MGC99678; |
| Gene ID | 2852 |
| mRNA Refseq | NM_001039966 |
| Protein Refseq | NP_001035055 |
| MIM | 601805 |
| UniProt ID | Q99527 |
| ◆ Recombinant Proteins | ||
| GPER-2637R | Recombinant Rat GPER Protein | +Inquiry |
| GPER-5230H | Recombinant Human GPER Protein, GST-tagged | +Inquiry |
| GPER-5528HF | Recombinant Full Length Human GPER Protein | +Inquiry |
| GPER-5532HF | Recombinant Full Length Human GPER Protein, GST-tagged | +Inquiry |
| GPER-2291R | Recombinant Rat GPER Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPER Products
Required fields are marked with *
My Review for All GPER Products
Required fields are marked with *
