Recombinant Full Length Human GPIHBP1 Protein, GST-tagged
| Cat.No. : | GPIHBP1-6942HF |
| Product Overview : | Recombinant Human full-length GPIHBP1(1 a.a. - 184 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 184 amino acids |
| Description : | Dietary fats are packaged by intestine into triglyceride-rich lipoproteins called chylomicrons. The triglycerides in chylomicrons are hydrolyzed by lipoprotein lipase (LPL: MIM 609708) along the luminal surface of capillaries, mainly in heart, skeletal muscle, and adipose tissue. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons. |
| Molecular Mass : | 46.2 kDa |
| AA Sequence : | MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDE RCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT GKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP |
| Applications : | ELISA; WB-Re; AP; Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | GPIHBP1 glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [ Homo sapiens (human) ] |
| Official Symbol | GPIHBP1 |
| Synonyms | GPIHBP1; GPI-HBP1; glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-anchored HDL-binding protein 1; high density lipoprotein-binding protein 1; GPI anchored high density lipoprotein binding protein 1 |
| Gene ID | 338328 |
| mRNA Refseq | NM_178172 |
| Protein Refseq | NP_835466 |
| MIM | 612757 |
| UniProt ID | Q8IV16 |
| ◆ Recombinant Proteins | ||
| GPIHBP1-674H | Recombinant Human GPIHBP1 Protein, Fc-tagged | +Inquiry |
| GPIHBP1-95H | Recombinant Human GPIHBP1, His-tagged | +Inquiry |
| GPIHBP1-1935R | Recombinant Rhesus monkey GPIHBP1 Protein, His-tagged | +Inquiry |
| GPIHBP1-1432H | Recombinant Human GPIHBP1, GST-tagged | +Inquiry |
| GPIHBP1-6745H | Recombinant Human GPIHBP1(Thr22-Gly151) Protein, C-Fc-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| GPIHBP1-5805HCL | Recombinant Human GPIHBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPIHBP1 Products
Required fields are marked with *
My Review for All GPIHBP1 Products
Required fields are marked with *
