Recombinant Human GPIHBP1, His-tagged
Cat.No. : | GPIHBP1-95H |
Product Overview : | Recombinant Human Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1/GPIHBP1 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Gln21-Ser160) of Human GPIHBP1 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 21-160 a.a. |
Description : | Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1 (GPIHBP1) is a single-pass membrane protein that contains one UPAR/Ly6 domain. GPIHBP1 is localized to the cell surface. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons. GPIHBP1 plays a key role in the lipolytic processing of chylomicrons. |
AA Sequence : | QTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDERCNLTQNCSH GQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT GKGAGGPRGSVDHHHHHH |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | GPIHBP1 glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [ Homo sapiens ] |
Official Symbol | GPIHBP1 |
Synonyms | GPIHBP1; glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1; GPI anchored high density lipoprotein binding protein 1; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI HBP1; LOC338328; GPI-anchored HDL-binding protein 1; high density lipoprotein-binding protein 1; GPI-HBP1; |
Gene ID | 338328 |
mRNA Refseq | NM_178172 |
Protein Refseq | NP_835466 |
MIM | 612757 |
UniProt ID | Q8IV16 |
Chromosome Location | 8q24.3 |
Function | apolipoprotein binding; chylomicron binding; high-density lipoprotein particle binding; lipase binding; lipid binding; lipoprotein particle binding; protein transmembrane transporter activity; |
◆ Recombinant Proteins | ||
RFL28252HF | Recombinant Full Length Human Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1(Gpihbp1) Protein, His-Tagged | +Inquiry |
GPIHBP1-6745H | Recombinant Human GPIHBP1(Thr22-Gly151) Protein, C-Fc-tagged | +Inquiry |
GPIHBP1-2361H | Recombinant Human GPIHBP1 protein, His-tagged | +Inquiry |
GPIHBP1-3832M | Recombinant Mouse GPIHBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPIHBP1-3060H | Recombinant Human GPIHBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPIHBP1-5805HCL | Recombinant Human GPIHBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPIHBP1 Products
Required fields are marked with *
My Review for All GPIHBP1 Products
Required fields are marked with *