Recombinant Human GPIHBP1, GST-tagged
Cat.No. : | GPIHBP1-1432H |
Product Overview : | Recombinant Human GPIHBP1(1 a.a. - 184 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Dietary fats are packaged by intestine into triglyceride-rich lipoproteins called chylomicrons. The triglycerides in chylomicrons are hydrolyzed by lipoprotein lipase (LPL: MIM 609708) along the luminal surface of capillaries, mainly in heart, skeletal muscle, and adipose tissue. GPIHBP1 is a capillary endothelial cell protein that provides a platform for LPL-mediated processing of chylomicrons. |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MKALGAVLLALLLCGRPGRGQTQQEEEEEDEDHGPDDYDEEDEDEVEEEETNRLPGGRSRVLLRCYTCKSLPRDE RCNLTQNCSHGQTCTTLIAHGNTESGLLTTHSTWCTDSCQPITKTVEGTQVTMTCCQSSLCNVPPWQSSRVQDPT GKGAGGPRGSSETVGAALLLNLLAGLGAMGARRP |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPIHBP1 glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | GPIHBP1 |
Synonyms | GPIHBP1; GPI-HBP1; glycosylphosphatidylinositol anchored high density lipoprotein binding protein 1; glycosylphosphatidylinositol-anchored high density lipoprotein-binding protein 1; GPI-anchored HDL-binding protein 1; high density lipoprotein-binding protein 1; GPI anchored high density lipoprotein binding protein 1 |
Gene ID | 338328 |
mRNA Refseq | NM_178172 |
Protein Refseq | NP_835466 |
MIM | 612757 |
UniProt ID | Q8IV16 |
Chromosome Location | 8q24.3 |
Function | chylomicron binding; high-density lipoprotein particle binding; lipase binding |
◆ Recombinant Proteins | ||
RFL28252HF | Recombinant Full Length Human Glycosylphosphatidylinositol-Anchored High Density Lipoprotein-Binding Protein 1(Gpihbp1) Protein, His-Tagged | +Inquiry |
GPIHBP1-2361H | Recombinant Human GPIHBP1 protein, His-tagged | +Inquiry |
GPIHBP1-1076H | Recombinant Human GPIHBP1 | +Inquiry |
GPIHBP1-3060H | Recombinant Human GPIHBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GPIHBP1-372H | Recombinant Human GPIHBP1 Protein, GST-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPIHBP1-5805HCL | Recombinant Human GPIHBP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPIHBP1 Products
Required fields are marked with *
My Review for All GPIHBP1 Products
Required fields are marked with *