Recombinant Full Length Human GPSM3 Protein, GST-tagged
Cat.No. : | GPSM3-5568HF |
Product Overview : | Human GPSM3 full-length ORF ( AAH18724, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 160 amino acids |
Description : | GPSM3 (G Protein Signaling Modulator 3) is a Protein Coding gene. Diseases associated with GPSM3 include Prostate Leiomyosarcoma and Griscelli Syndrome, Type 1. GO annotations related to this gene include GTPase regulator activity and GDP-dissociation inhibitor activity. |
Molecular Mass : | 43.34 kDa |
AA Sequence : | MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GPSM3 G-protein signaling modulator 3 [ Homo sapiens ] |
Official Symbol | GPSM3 |
Synonyms | GPSM3; G-protein signaling modulator 3; C6orf9, chromosome 6 open reading frame 9, G protein signalling modulator 3 (AGS3 like, C. elegans); G-protein-signaling modulator 3; activator of G protein signaling 4; AGS4; G18; G18.1a; G18.1b; G18.2; NG1; activator of G-protein signaling 4; G-protein signaling modulator 3 (AGS3-like, C. elegans); G-protein signalling modulator 3 (AGS3-like, C. elegans); C6orf9; |
Gene ID | 63940 |
mRNA Refseq | NM_022107 |
Protein Refseq | NP_071390 |
MIM | 618558 |
UniProt ID | Q9Y4H4 |
◆ Recombinant Proteins | ||
Gpsm3-301M | Recombinant Mouse Gpsm3 Protein, MYC/DDK-tagged | +Inquiry |
GPSM3-5302H | Recombinant Human GPSM3 Protein, GST-tagged | +Inquiry |
GPSM3-1963R | Recombinant Rhesus monkey GPSM3 Protein, His-tagged | +Inquiry |
GPSM3-5568HF | Recombinant Full Length Human GPSM3 Protein, GST-tagged | +Inquiry |
GPSM3-2675R | Recombinant Rat GPSM3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
GPSM3-5764HCL | Recombinant Human GPSM3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GPSM3 Products
Required fields are marked with *
My Review for All GPSM3 Products
Required fields are marked with *
0
Inquiry Basket