Recombinant Full Length Human GPSM3 Protein, GST-tagged

Cat.No. : GPSM3-5568HF
Product Overview : Human GPSM3 full-length ORF ( AAH18724, 1 a.a. - 160 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 160 amino acids
Description : GPSM3 (G Protein Signaling Modulator 3) is a Protein Coding gene. Diseases associated with GPSM3 include Prostate Leiomyosarcoma and Griscelli Syndrome, Type 1. GO annotations related to this gene include GTPase regulator activity and GDP-dissociation inhibitor activity.
Molecular Mass : 43.34 kDa
AA Sequence : MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVAEAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLLRVQGGGRMEEQRSRPPTHTC
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPSM3 G-protein signaling modulator 3 [ Homo sapiens ]
Official Symbol GPSM3
Synonyms GPSM3; G-protein signaling modulator 3; C6orf9, chromosome 6 open reading frame 9, G protein signalling modulator 3 (AGS3 like, C. elegans); G-protein-signaling modulator 3; activator of G protein signaling 4; AGS4; G18; G18.1a; G18.1b; G18.2; NG1; activator of G-protein signaling 4; G-protein signaling modulator 3 (AGS3-like, C. elegans); G-protein signalling modulator 3 (AGS3-like, C. elegans); C6orf9;
Gene ID 63940
mRNA Refseq NM_022107
Protein Refseq NP_071390
MIM 618558
UniProt ID Q9Y4H4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPSM3 Products

Required fields are marked with *

My Review for All GPSM3 Products

Required fields are marked with *

0
cart-icon