Recombinant Full Length Human GPX1 Protein, GST-tagged

Cat.No. : GPX1-5579HF
Product Overview : Human GPX1 full-length ORF ( NP_000572.2, 1 a.a. - 48 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 48 amino acids
Description : This gene encodes a member of the glutathione peroxidase family. Glutathione peroxidase functions in the detoxification of hydrogen peroxide, and is one of the most important antioxidant enzymes in humans. This protein is one of only a few proteins known in higher vertebrates to contain selenocysteine, which occurs at the active site of glutathione peroxidase and is coded by UGA, that normally functions as a translation termination codon. In addition, this protein is characterized in a polyalanine sequence polymorphism in the N-terminal region, which includes three alleles with five, six or seven alanine (ALA) repeats in this sequence. The allele with five ALA repeats is significantly associated with breast cancer risk. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 31.1 kDa
AA Sequence : MCAARLAAAAAAAQSVYAFSARPLAGGEPVSLGSLRGKVLLIENVASL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPX1 glutathione peroxidase 1 [ Homo sapiens ]
Official Symbol GPX1
Synonyms GPX1; glutathione peroxidase 1; GPx-1; GSHPx-1; cellular glutathione peroxidase; GPXD; GSHPX1; MGC14399; MGC88245;
Gene ID 2876
mRNA Refseq NM_000581
Protein Refseq NP_000572
MIM 138320
UniProt ID P07203

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX1 Products

Required fields are marked with *

My Review for All GPX1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon