Recombinant Full Length Human GPX8 Protein, GST-tagged

Cat.No. : GPX8-5589HF
Product Overview : Human GPX8 full-length ORF ( NP_001008398.1, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 209 amino acids
Description : GPX8 (Glutathione Peroxidase 8 (Putative)) is a Protein Coding gene. Among its related pathways are Glutathione metabolism and Cellular Senescence. GO annotations related to this gene include oxidoreductase activity and peroxidase activity. An important paralog of this gene is GPX7.
Molecular Mass : 50.3 kDa
AA Sequence : MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPX8 glutathione peroxidase 8 (putative) [ Homo sapiens ]
Official Symbol GPX8
Synonyms GPX8; glutathione peroxidase 8 (putative); probable glutathione peroxidase 8; EPLA847; UNQ847; GPx-8; GSHPx-8;
Gene ID 493869
mRNA Refseq NM_001008397
Protein Refseq NP_001008398
MIM 617172
UniProt ID Q8TED1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GPX8 Products

Required fields are marked with *

My Review for All GPX8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon