Recombinant Full Length Human GRAP2 Protein, GST-tagged
Cat.No. : | GRAP2-5318HF |
Product Overview : | Human GRAP2 full-length ORF ( NP_004801.1, 1 a.a. - 330 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 330 amino acids |
Description : | This gene encodes a member of the GRB2/Sem5/Drk family. This member is an adaptor-like protein involved in leukocyte-specific protein-tyrosine kinase signaling. Like its related family member, GRB2-related adaptor protein (GRAP), this protein contains an SH2 domain flanked by two SH3 domains. This protein interacts with other proteins, such as GRB2-associated binding protein 1 (GAB1) and the SLP-76 leukocyte protein (LCP2), through its SH3 domains. Transcript variants utilizing alternative polyA sites exist. [provided by RefSeq |
Molecular Mass : | 64.3 kDa |
AA Sequence : | MEAVAKFDFTASGEDELSFHTGDVLKILSNQEEWFKAELGSQEGYVPKNFIDIQFPKWFHEGLSRHQAENLLMGKEVGFFIIRASQSSPGDFSISVRHEDDVQHFKVMRDNKGNYFLWTEKFPSLNKLVDYYRTNSISRQKQIFLRDRTREDQGHRGNSLDRRSQGGPHLSGAVGEEIRPSMNRKLSDHPPTLPLQQHQHQPQPPQYAPAPQQLQQPPQQRYLQHHHFHQERRGGSLDINDGHCGTGLGSEMNAALMHRRHTDPVQLQAAGRVRWARALYDFEALEDDELGFHSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMTR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRAP2 GRB2-related adaptor protein 2 [ Homo sapiens ] |
Official Symbol | GRAP2 |
Synonyms | GRAP2; GRB2-related adaptor protein 2; GRB2-related adapter protein 2; GADS; GRBLG; GrbX; Grf40; Mona; grf-40; GRB-2-like protein; adapter protein GRID; grf40 adapter protein; SH3-SH2-SH3 adapter Mona; SH3-SH2-SH3 adaptor molecule; growth factor receptor-binding protein; GRB2-related protein with insert domain; hematopoietic cell-associated adapter protein GrpL; hematopoietic cell-associated adaptor protein GRPL; growth factor receptor-bound protein 2-related adaptor protein 2; P38; GRID; GRPL; GRB2L; GRAP-2; |
Gene ID | 9402 |
mRNA Refseq | NM_004810 |
Protein Refseq | NP_004801 |
MIM | 604518 |
UniProt ID | O75791 |
◆ Recombinant Proteins | ||
GRAP2-1969R | Recombinant Rhesus monkey GRAP2 Protein, His-tagged | +Inquiry |
GRAP2-5033H | Recombinant Human GRAP2 Protein, GST-tagged | +Inquiry |
GRAP2-5318HF | Recombinant Full Length Human GRAP2 Protein, GST-tagged | +Inquiry |
GRAP2-3303H | Recombinant Human GRAP2 Protein (Val77-Val325), N-His tagged | +Inquiry |
Grap2-1603R | Recombinant Rat Grap2 protein, His & T7-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRAP2-5757HCL | Recombinant Human GRAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GRAP2 Products
Required fields are marked with *
My Review for All GRAP2 Products
Required fields are marked with *