Recombinant Full Length Human Graves Disease Carrier Protein(Slc25A16) Protein, His-Tagged
Cat.No. : | RFL10420HF |
Product Overview : | Recombinant Full Length Human Graves disease carrier protein(SLC25A16) Protein (P16260) (1-332aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-332) |
Form : | Lyophilized powder |
AA Sequence : | MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRV KVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTL ITTKLGISGHVHRLMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYA KEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKT HVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGL YRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SLC25A16 |
Synonyms | SLC25A16; GDA; Graves disease carrier protein; GDC; Graves disease autoantigen; Mitochondrial solute carrier protein homolog; Solute carrier family 25 member 16 |
UniProt ID | P16260 |
◆ Recombinant Proteins | ||
Slc25a16-5911M | Recombinant Mouse Slc25a16 Protein, Myc/DDK-tagged | +Inquiry |
SLC25A16-15301M | Recombinant Mouse SLC25A16 Protein | +Inquiry |
SLC25A16-11594Z | Recombinant Zebrafish SLC25A16 | +Inquiry |
SLC25A16-8272M | Recombinant Mouse SLC25A16 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL10420HF | Recombinant Full Length Human Graves Disease Carrier Protein(Slc25A16) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A16-1780HCL | Recombinant Human SLC25A16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC25A16 Products
Required fields are marked with *
My Review for All SLC25A16 Products
Required fields are marked with *