Recombinant Full Length Human GREM2 Protein, GST-tagged

Cat.No. : GREM2-5608HF
Product Overview : Human GREM2 full-length ORF ( AAH46632.1, 1 a.a. - 168 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 168 amino acids
Description : This gene encodes a member of the BMP (bone morphogenic protein) antagonist family. Like BMPs, BMP antagonists contain cystine knots and typically form homo- and heterodimers. The CAN (cerberus and dan) subfamily of BMP antagonists, to which this gene belongs, is characterized by a C-terminal cystine knot with an eight-membered ring. The antagonistic effect of the secreted glycosylated protein encoded by this gene is likely due to its direct binding to BMP proteins. As an antagonist of BMP, this gene may play a role in regulating organogenesis, body patterning, and tissue differentiation. [provided by RefSeq
Molecular Mass : 44.22 kDa
AA Sequence : MFWKLSLSLFMVAVLVKVAEARKNRPAGAIHSPYKDGSSNNSERWQHQIKEVLASSQEALVVTERKYLKSDWCKTQPLRQTVSEEGCRSRTILNRFCCGQCNSFYIPRHVKKEEESFQSCAFCKPQRVTSVLVELECPGLDPPFRLKKIQKVKQCRCMSVNLSDSDKQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GREM2 gremlin 2 [ Homo sapiens ]
Official Symbol GREM2
Synonyms GREM2; gremlin 2; gremlin 2, cysteine knot superfamily, homolog (Xenopus laevis); gremlin-2; CKTSF1B2; DAND3; FLJ21195; Prdc; protein related to DAN and cerberus; DAN domain family member 3; cysteine knot superfamily 1, BMP antagonist 2; gremlin 2, cysteine knot superfamily, homolog; PRDC;
Gene ID 64388
mRNA Refseq NM_022469
Protein Refseq NP_071914
MIM 608832
UniProt ID Q9H772

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GREM2 Products

Required fields are marked with *

My Review for All GREM2 Products

Required fields are marked with *

0
cart-icon
0
compare icon