Recombinant Full Length Human Group Xvi Phospholipase A1/A2(Pla2G16) Protein, His-Tagged
Cat.No. : | RFL17668HF |
Product Overview : | Recombinant Full Length Human Group XVI phospholipase A1/A2(PLA2G16) Protein (P53816) (1-162aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-162) |
Form : | Lyophilized powder |
AA Sequence : | MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAGSDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVAGMGLAAMSLIGVMFSRNKRQKQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | PLA2G16 |
Synonyms | PLAAT3; HRASLS3; HREV107; PLA2G16; Phospholipase A and acyltransferase 3; Adipose-specific phospholipase A2; AdPLA; Group XVI phospholipase A1/A2; H-rev 107 protein homolog; H-REV107; HREV107-1; HRAS-like suppressor 1; HRAS-like suppressor 3; HRSL3; HREV1 |
UniProt ID | P53816 |
◆ Recombinant Proteins | ||
PLA2G16-4146R | Recombinant Rat PLA2G16 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G16-6796M | Recombinant Mouse PLA2G16 Protein, His (Fc)-Avi-tagged | +Inquiry |
PLA2G16-3454R | Recombinant Rhesus monkey PLA2G16 Protein, His-tagged | +Inquiry |
PLA2G16-28758TH | Recombinant Human PLA2G16 | +Inquiry |
PLA2G16-387H | Recombinant Human Phospholipase A2, Group XVI | +Inquiry |
◆ Cell & Tissue Lysates | ||
PLA2G16-3143HCL | Recombinant Human PLA2G16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PLA2G16 Products
Required fields are marked with *
My Review for All PLA2G16 Products
Required fields are marked with *