Recombinant Full Length Human Growth Hormone-Inducible Transmembrane Protein(Ghitm) Protein, His-Tagged
Cat.No. : | RFL15372HF |
Product Overview : | Recombinant Full Length Human Growth hormone-inducible transmembrane protein(GHITM) Protein (Q9H3K2) (45-345aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (45-345) |
Form : | Lyophilized powder |
AA Sequence : | YATKTRIGIRRGRTGQELKEAALEPSMEKIFKIDQMGRWFVAGGAAVGLGALCYYGLGLS NEIGAIEKAVIWPQYVKDRIHSTYMYLAGSIGLTALSAIAISRTPVLMNFMMRGSWVTIG VTFAAMVGAGMLVRSIPYDQSPGPKHLAWLLHSGVMGAVVAPLTILGGPLLIRAAWYTAG IVGGLSTVAMCAPSEKFLNMGAPLGVGLGLVFVSSLGSMFLPPTTVAGATLYSVAMYGGL VLFSMFLLYDTQKVIKRAEVSPMYGVQKYDPINSMLSIYMDTLNIFMRVATMLATGGNRK K |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GHITM |
Synonyms | GHITM; DERP2; MICS1; TMBIM5; My021; UNQ244/PRO281; Growth hormone-inducible transmembrane protein; Dermal papilla-derived protein 2; Mitochondrial morphology and cristae structure 1; Transmembrane BAX inhibitor motif-containing protein 5 |
UniProt ID | Q9H3K2 |
◆ Recombinant Proteins | ||
GHITM-2880C | Recombinant Chicken GHITM | +Inquiry |
GHITM-5251HF | Recombinant Full Length Human GHITM Protein, GST-tagged | +Inquiry |
GHITM-2527R | Recombinant Rat GHITM Protein | +Inquiry |
RFL22312RF | Recombinant Full Length Rat Growth Hormone-Inducible Transmembrane Protein(Ghitm) Protein, His-Tagged | +Inquiry |
RFL8157MF | Recombinant Full Length Mouse Growth Hormone-Inducible Transmembrane Protein(Ghitm) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHITM-5942HCL | Recombinant Human GHITM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GHITM Products
Required fields are marked with *
My Review for All GHITM Products
Required fields are marked with *
0
Inquiry Basket