Recombinant Full Length Human GRPEL2 Protein, GST-tagged
Cat.No. : | GRPEL2-5605HF |
Product Overview : | Human GRPEL2 full-length ORF ( NP_689620.2, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 225 amino acids |
Description : | GRPEL2 (GrpE Like 2, Mitochondrial) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. GO annotations related to this gene include protein homodimerization activity and chaperone binding. An important paralog of this gene is GRPEL1. |
Molecular Mass : | 51.8 kDa |
AA Sequence : | MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GRPEL2 GrpE-like 2, mitochondrial (E. coli) [ Homo sapiens ] |
Official Symbol | GRPEL2 |
Synonyms | GRPEL2; GrpE-like 2, mitochondrial (E. coli); grpE protein homolog 2, mitochondrial; DKFZp451C205; FLJ23713; Mt GrpE#2; Mt-GrpE#2; FLJ33918; |
Gene ID | 134266 |
mRNA Refseq | NM_152407 |
Protein Refseq | NP_689620 |
MIM | 618545 |
UniProt ID | Q8TAA5 |
◆ Recombinant Proteins | ||
GRPEL2-1980R | Recombinant Rhesus monkey GRPEL2 Protein, His-tagged | +Inquiry |
GRPEL2-7294M | Recombinant Mouse GRPEL2 Protein | +Inquiry |
GRPEL2-5605HF | Recombinant Full Length Human GRPEL2 Protein, GST-tagged | +Inquiry |
GRPEL2-3945M | Recombinant Mouse GRPEL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
GRPEL2-8403Z | Recombinant Zebrafish GRPEL2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GRPEL2-755HCL | Recombinant Human GRPEL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRPEL2 Products
Required fields are marked with *
My Review for All GRPEL2 Products
Required fields are marked with *
0
Inquiry Basket